KEGG   Acinetobacter baumannii AB0057: AB57_3756Help
Entry
AB57_3756         CDS       T00793                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00010  Glycolysis / Gluconeogenesis
abn00620  Pyruvate metabolism
abn00640  Propanoate metabolism
abn00680  Methane metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_3756
   00620 Pyruvate metabolism
    AB57_3756
   00640 Propanoate metabolism
    AB57_3756
  Energy metabolism
   00680 Methane metabolism
    AB57_3756
Enzymes [BR:abn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AB57_3756
Lipid biosynthesis proteins [BR:abn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AB57_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACJ43110
Position
complement(3877436..3879385)
Genome map
AA seq 649 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVASTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHESV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELISWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLIATVYPDRQK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactactttaaacgttatcaacactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaataccagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaacgtatcagcaaactgcttg
gacaggcatcttaaagaacaccctcacaaacctgcaattatttgggaaggtgaccatcct
tctcgtcataaaatcgtttcttataaagaattacacgacgaagtctgccgtttcgccaac
gttttaaagaaatatggcattggtaaaggtgaccgcgttgtgctgtatatgccaatggtg
actgaggctgcaattgccatgttagcctgtgcccgtattggtgcggtgcactgcgtggta
tttggtggtttctcaccagactcgttggcgagtcgtattgaagatagccaagctaaactt
gtgattacggctgactcaagcctacgtgccggtaagttgttaccacttaaagaaaatgtt
gatttggctctagcattgccgggcacagagtgcgttgaaaacgtgattgtggtttaccgt
aatgcaaacccaatcgagatgaagccgggtcgtgatttgtggtatcaccttattattatg
gaggtggatgcaaactgtcctccagaaccaatgaaggccgaagaccctttatttattctt
tatacctctggctcgacaggtaaacctaaaggagtgttgcatactacaggtggttatctg
gtgtatgtggcgagtacctttaaagaagtttttgatttaaaacaagatgatgtgtactgg
tgtaccgctgatgtcggctggattacaggccatagttatctaatctatggaccattggca
aatggtacgacgaccttaatgtttgaaggtgtgcctcagtatccaacatgggcacgtctt
ggtcatgtggtcgataaacataaagtctctattttatatacagcgccaaccgcgattcga
gccatgatgcgagaaggtgattcgtatgtacgtgaaagtaaccgtagtagtttgcgtttg
ttaggttcagtgggtgaacctattaaccctgaggcttggaactggtactacaatgttgtc
ggcgaaggccgctgcccgattgttgatacatggtggcaaaccgaaacaggtggtattttg
attgcgccattaccgggggcaacagctttaaaaccaggttcggcaacgcgacctttattt
ggtattcaaccagctattgtagatggtgaaggcaatgaactagaaggcgctgccgaaggt
aatcttgtgattaaagattcatggccgggccagatgcgtaccatttggggtgacccagat
cgctttattgaagcttacttctcgacctttaaaaatacttattttacaggtgatggcgcc
cgccgtgatgaagatggctattactggatcacgggtcgtgttgacgatgtcttaaacgtt
tcaggccaccgtctaggtacggctgaaattgaaagtgctcttgtatcgcatgaatcggtg
gcagaggctgctgttgtaggtatgccgcatgatattaaagggcagggtatttgtactttt
gtgactttgcaggcgggtgttccggagtcggaagaactgcgaaaagagttaattagctgg
gtacgtaaagtacttggaccagtggcttcaccagatgcactgcactgggcgccggcatta
cctaaaacccgttcgggtaaaatcatgcgccgtattttaagaaaaattgcagcgaatgaa
ctggatagtttgggcgatacctcaaccctagctgaaccggcagtggtggatcaactgatt
gcgacagtttatcctgatagacaaaaataa

DBGET integrated database retrieval system