KEGG   Alcanivorax borkumensis: ABO_0334Help
Entry
ABO_0334          CDS       T00380                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00010  Glycolysis / Gluconeogenesis
abo00620  Pyruvate metabolism
abo00640  Propanoate metabolism
abo00680  Methane metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_0334 (acsA)
   00620 Pyruvate metabolism
    ABO_0334 (acsA)
   00640 Propanoate metabolism
    ABO_0334 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ABO_0334 (acsA)
Enzymes [BR:abo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABO_0334 (acsA)
Lipid biosynthesis proteins [BR:abo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABO_0334 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAL15782
UniProt: Q0VSR6
Position
complement(367545..369482)
Genome map
AA seq 645 aa AA seqDB search
MSQVHIHPVPADYKKQTLMDRETYDRWYSQSINDPGTFWAERAEQLLDWKTPWDTVSEWD
FNEGRAAWFKGATLNACYNCVDRHLPERANQTAIIWEGDEPDQDKHISYQQLFEEVSKFG
NVLKNRGVKKGDRVVIYMPMIPEAAYAMLACARIGAIHSVVFGGFSPEALKDRILNAEAC
ALITADEGVRGGKTIPLKVNADKALDGIDCVHTCLTVKRTGGDVDWQAPRDVWYHEAMAD
ASSDCEPEWVEAEDPLFTLYTSGSTGKPKGVVHTTAGYLLNTALTHKYVFDYQDGDIYWC
TADVGWITGHSYIVYGPLANGATTLMFEGVPTYPDASRCWQVVDKHKVNIFYTAPTAIRA
LMGLGDAPVEQTSRASLKLLGTVGEPINPEAWEWYYRVVGDSRCPIVDTWWQTETGAIMI
APLPGAVDLKAGSATLPMFGVQPGLMDPDGNELDGAASGNLVLKASWPSQIRTVYGDHQR
LIDTYFSAYKGCYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVLHPSIS
EAAVVGYQHDVKGQGIYAYVSLMAGKEGSEELVKALRDLVTQEIGPIAKPDLIHFAPGLP
KTRSGKIMRRILRKIAADELDSLGDTSTLADPSVVDQLIDNRQNK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagtacatattcaccctgttcccgccgactataaaaagcaaacactgatggat
cgcgagacttacgatcgctggtacagccaatccattaatgatccgggcaccttctgggcc
gagcgcgcagaacagcttctggactggaaaactccgtgggacacggtaagcgaatgggac
tttaacgaaggccgggccgcttggttcaaaggcgccaccctcaacgcctgttacaattgt
gtcgaccgccacctgccggaacgggccaaccagaccgccattatctgggagggcgacgag
ccagatcaggacaaacacataagctatcaacagctgttcgaggaagtgagcaagttcggc
aatgtgctcaagaatcgaggtgttaagaaaggcgatcgcgttgtcatctatatgccgatg
attccggaagcggcctacgccatgctggcctgcgctcgcattggcgccatccactctgtt
gtctttggcggtttctcgccggaagctctgaaagaccgcattctcaatgctgaggcttgc
gctctgattaccgccgacgaaggggtacgcggtggcaaaaccatcccgctgaaagtaaat
gcagacaaggccctagacggtatcgactgtgttcacacctgcctgaccgtaaagcgcacc
ggcggagatgtggattggcaagcaccgcgagatgtctggtaccacgaggccatggcggat
gcgtccagcgattgcgaaccggagtgggtcgaggctgaagacccattattcaccctctac
acctctggctccaccggcaaacccaaaggggttgtccacaccaccgccggctatttgctc
aacactgctctaacccataaatacgtgttcgactatcaggacggggacatctactggtgc
accgccgatgtgggctggatcactggacacagctacattgtttacggcccgctggctaac
ggcgccaccacgctgatgttcgaaggcgtgcccacctacccggacgcctcacgctgctgg
caggtagtcgacaagcacaaggtaaacattttctacaccgcgcctaccgctattcgcgcc
ctcatggggctgggcgatgcccctgtggaacaaacctcccgcgccagcctgaagctgctg
ggcaccgtgggcgaacccatcaacccggaagcctgggagtggtattacagggtagtcggt
gacagccgctgcccgattgtagacacctggtggcaaactgaaaccggcgccatcatgatt
gcgccgctacccggcgcagtggacctgaaagccgggtctgccactctgcccatgttcggg
gtgcaacccggcctaatggaccctgacggtaacgaactggacggtgccgcctccggcaac
ctagtgctcaaggccagttggcctagccaaattcgcaccgtctatggcgatcaccaacgc
ctaatcgatacctacttcagtgcctacaagggctgctacttcactggcgacggcgcccgc
cgcgatgaagatggctactactggattactggccgggtggatgacgtgctcaacgtgtct
ggccaccgcctaggcacagctgaaatcgaatccgctctagtactacaccccagcatctct
gaagcggccgtggtgggctaccagcatgacgtaaaagggcaagggatctatgcctacgta
tcgttaatggccggcaaggaaggcagcgaagaactggtcaaggctctccgcgacctagtg
acacaggaaattgggcccatcgccaagcccgacctgattcactttgcaccgggcctgccg
aaaacccgctctggcaaaatcatgcgccgtattttacgcaaaatcgccgcggatgaactg
gatagcctgggcgacacctccaccttagctgatcccagcgtggttgatcagctcatcgat
aaccgccaaaacaagtaa

DBGET integrated database retrieval system