KEGG   Alcanivorax borkumensis: ABO_0937Help
Entry
ABO_0937          CDS       T00380                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00010  Glycolysis / Gluconeogenesis
abo00030  Pentose phosphate pathway
abo00051  Fructose and mannose metabolism
abo00052  Galactose metabolism
abo00230  Purine metabolism
abo00500  Starch and sucrose metabolism
abo00520  Amino sugar and nucleotide sugar metabolism
abo00521  Streptomycin biosynthesis
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABO_0937 (algC)
   00030 Pentose phosphate pathway
    ABO_0937 (algC)
   00051 Fructose and mannose metabolism
    ABO_0937 (algC)
   00052 Galactose metabolism
    ABO_0937 (algC)
   00500 Starch and sucrose metabolism
    ABO_0937 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    ABO_0937 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    ABO_0937 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABO_0937 (algC)
Enzymes [BR:abo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABO_0937 (algC)
    5.4.2.8  phosphomannomutase
     ABO_0937 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAL16385
UniProt: Q0VR13
Position
1049961..1051343
Genome map
AA seq 460 aa AA seqDB search
MTLMTHPIPASIFRAYDIRGIYNETLTDAWAYEIGRAIGSEVQAQGQTAIAIGRDGRLSG
PALLQALSEGVQSTGCAVVNVGLVPTPVLYFATHHIEGLNSGVMLTGSHNPGNYNGFKIV
IDGVTLSGERIQALHRRIVDQRFAEGQGEYREQDVLVDYQAAFLSAHSLARPMKVVVDCG
NGITGLQAPQVLEALGCEVVPLFTDVDGTFPNHHPDPGDLNNLQDLIASVKAEKADLGLA
FDGDGDRVGVVTPAGEVVYPDILLMALAEDMVSRHPGAKVIFDVKCTGSLFDVIRDAGGE
PEMWQTGHSLIKARMKETGALLAGEMSGHIFFAEDWYGFDDALVAAARILGIISRTEGGA
EALFGRYPVLCTTPEININVTDENKFRIVEYLQTNAEFGEGERRVIDGIRMDYADGWGLC
RASNTSPKLVLRFEADNDEALGRIRDLFEVNVSKAMAAVG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacattaatgactcaccccattcccgcttcgatttttcgtgcttacgatattcgcggt
atttataacgaaacgctcacggatgcatgggcttatgaaattggtcgggcgattgggtcc
gaggtgcaagctcaaggacagacggccatcgctatagggcgagatgggcgcttgtctggt
cccgctttgttgcaggccttgagtgagggtgttcagtccacggggtgcgcagtagtgaat
gtggggttggtaccgacgcctgtgctgtattttgcaacgcatcatattgaggggctcaat
tccggtgtgatgctgactggtagccataacccgggcaattacaatggttttaaaattgta
attgacggtgtgacactctcgggtgaacgcattcaggcgttgcatcgcagaattgtagat
cagcgctttgctgaagggcagggcgagtatcgtgagcaggatgtgctggtggactaccag
gctgcgtttttgagcgcccatagcctagcgcgacctatgaaggtggttgtggattgtggc
aatggcatcactggtttacaggcaccgcaagtgcttgaggcgttagggtgtgaggttgtg
ccgctgttcactgacgtggacggcaccttcccgaatcatcacccggacccgggtgacctc
aacaatttgcaggatttaattgctagcgtaaaagcagaaaaggccgaccttggattggct
tttgatggtgacggcgatcgggttggggttgttacacctgctggagaggtggtgtatccg
gatattctgctaatggcgctggcagaggatatggtgagcaggcatcccggcgcaaaagtt
atttttgatgtgaagtgcacaggctccctgttcgacgtgattagggacgccgggggggag
ccagaaatgtggcaaaccggacactcccttatcaaagcacgcatgaaagaaaccggtgcc
ttgttagcaggagagatgagtgggcatatcttttttgctgaagattggtacggctttgat
gatgccttggtggctgctgccaggatactgggtatcatcagccgaacagagggaggcgcg
gaggcccttttcgggcgctacccggtgctgtgcacgaccccggaaatcaatatcaatgtg
acggacgagaacaaattccgtatcgtggaatatctgcagacgaatgcggagttcggcgaa
ggcgagcgccgcgtcattgatggtatccgtatggattatgccgatggttggggcctgtgt
cgggcctccaatacttcgccgaagttagtgttgcgttttgaggcagataacgatgaagcc
ctaggccgaattcgtgacttgttcgaggttaacgtaagcaaagcgatggccgcggtgggt
taa

DBGET integrated database retrieval system