KEGG   Alcanivorax borkumensis: ABO_0983Help
Entry
ABO_0983          CDS       T00380                                 

Gene name
pcaF
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00071  Fatty acid degradation
abo00072  Synthesis and degradation of ketone bodies
abo00280  Valine, leucine and isoleucine degradation
abo00310  Lysine degradation
abo00362  Benzoate degradation
abo00380  Tryptophan metabolism
abo00620  Pyruvate metabolism
abo00630  Glyoxylate and dicarboxylate metabolism
abo00640  Propanoate metabolism
abo00650  Butanoate metabolism
abo00900  Terpenoid backbone biosynthesis
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
abo01212  Fatty acid metabolism
abo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_0983 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_0983 (pcaF)
   00640 Propanoate metabolism
    ABO_0983 (pcaF)
   00650 Butanoate metabolism
    ABO_0983 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABO_0983 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    ABO_0983 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_0983 (pcaF)
   00310 Lysine degradation
    ABO_0983 (pcaF)
   00380 Tryptophan metabolism
    ABO_0983 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABO_0983 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_0983 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABO_0983 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abo04147]
    ABO_0983 (pcaF)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABO_0983 (pcaF)
Exosome [BR:abo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABO_0983 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CAL16431
UniProt: Q0VQW7
Position
1107771..1108979
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYDGLRTPFGRHGGVLASVRPDDLLAGVIRELVQRNGFAASLYEDVVIGNTNQAG
EDARNVARHAGLLAGLPQSVAGITVNRLCGSGLAATLDAARMVTVGEGELIIAGGTESMS
RAPYVMAKAEKAFSREMTVFDSTIGARFPNPKVLKQFGADTMPQTAQNVAHDLGISREDA
DAFAIQSQQRYEVAREQGFYQQEVLPVTVPQGGKATPLRVADDEHPRPGTCVDKLRQLPA
IVDGGIITAGNASGINDGAAAVIVGSRRAGVAAGIAPRARVLSGAVAGVAPRVMGLGPVD
ACNKALARAGLALAQMDVIEINEAFAAQVLGCCKQLGLAGDDERLNPNGGAIAVGHPLGA
SGARLVLTAMRQLERTRGRYALLSLCIGVGQGVAMVLERVDS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcctatatctacgatggtctgcgtaccccttttggtcgccatggcggcgtt
ctggcatcggtacgcccggatgacctcttggccggagtgattcgcgaactggtacagcga
aatggctttgcggcttctctgtatgaagatgttgtcattggtaatactaatcaggcgggg
gaagatgcccgtaatgtggctcgtcatgccgggttattagctgggttgccgcagtccgtg
gcggggatcaccgtgaataggttatgtggcagcggcctcgccgcaacattggatgcggca
cgtatggtgacggtgggcgagggcgagttgatcattgccggtggtacggaatcgatgagc
cgtgccccttatgtaatggccaaagcagaaaaagcgtttagccgggagatgacagttttc
gatagcactatcggcgcccgcttccctaacccgaaagtgctcaagcagtttggtgccgat
actatgccgcagacggcacagaatgtagcgcacgacctgggtattagccgtgaagatgcg
gatgcttttgctatacagtctcaacaacgctatgaggtcgcccgtgagcaagggttttat
cagcaggaagtgttaccggttacggtgccccaggggggcaaggcgacaccactgcgtgtg
gctgacgacgaacatccccgccccggaacctgcgttgataagttgcgacaactgcctgct
attgtcgatgggggcattattactgcgggtaatgcgtctgggataaatgacggggcggcg
gcagtgattgtgggttcgcgtagggctggtgtggcggcgggtattgctccccgtgctcga
gttctgtctggtgcggttgccggagtggcgcctcgcgttatgggcctaggcccggtggat
gcgtgcaacaaggcattggcccgggcgggcctggcgttagctcagatggatgtgattgaa
attaatgaggcgtttgccgcccaagtgctgggctgctgtaagcagttgggcttggctggg
gatgatgagcgcctgaacccaaatggtggcgctattgctgtcggccatccgttaggtgcg
tccggtgcgcgtttggtcttgactgccatgcgtcagttggagcgaacccgcggtcgttat
gcacttcttagtttgtgcattggcgtaggtcagggcgttgccatggtgctggagagggta
gattcatga

DBGET integrated database retrieval system