KEGG   Alcanivorax borkumensis: ABO_1562Help
Entry
ABO_1562          CDS       T00380                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
abo  Alcanivorax borkumensis
Brite
KEGG Orthology (KO) [BR:abo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abo03009]
    ABO_1562
Enzymes [BR:abo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ABO_1562
Ribosome biogenesis [BR:abo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABO_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CAL17010
UniProt: Q0VP88
Position
complement(1783100..1784161)
Genome map
AA seq 353 aa AA seqDB search
MHSDLLNSQSETLLALCRPGFEADLAAELNFHAADQMVAGYPRATANSGYVLWHSQQGSL
ASLQESGLIFARTLSVCEGEFSDIGDDRISALWPLLEAAGPFSELYLEHPDTNEGRELQR
FLRGFRKALEPRLKKVGLLRRQAKQRLHLFFSDSHNGWVGTSPSAVPLVEGGVLRLRLPA
EAPSRSALKVEEALIRFFGSADALNAKTAVDLGAAPGGWSWQLARRGIRVQAVDHGKMAP
RLLDEYPVQHVYGDAFTWRPRSKVDLVVCDVVDKPARTLQHMEKWLTQGWATAALFNLKL
PMKRRFQETWQLLEKLTAAMERMDHLGEPVIKAAHLYYDREEITVWASFHRSY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtgacttgttgaattcccagtccgagaccttgctggccctgtgtcgaccgggc
tttgaggctgacctggctgccgaattgaatttccacgcggcagatcaaatggtggccggt
tatccccgcgctaccgccaatagtgggtatgtgctctggcatagccaacaaggctcgttg
gcgagcctgcaagaaagcggcttgatctttgcccgcacgctaagtgtatgcgagggcgag
tttagcgatataggcgacgaccgtatcagtgctttgtggcctttgttggaagccgcaggc
ccctttagtgagctatatcttgaacacccggataccaatgaaggacgcgagctgcagcgg
ttcttgcgtggttttcgcaaggcattggaacctcggttgaagaaagtcggcttgctgcgc
cgccaagcgaaacagcggctacatctttttttcagtgattcacacaatggttgggttggc
accagccccagcgctgtgccgcttgtagaaggtggtgtgttgcgcttgcgattacctgca
gaagcgccgagccgttcggcactaaaagtggaagaggcgttgatacgtttctttggtagt
gccgatgcgttaaacgccaaaacagcggtggacttgggggcggccccggggggctggagc
tggcaactggcccgacggggcattcgtgtgcaggcggtggaccacggcaagatggccccc
cggctgctggacgaatacccggtgcagcatgtctacggtgatgcctttacttggcgcccg
cgcagtaaggtggatctggtggtgtgcgatgtggtggacaagcctgcccgtactttgcaa
cacatggaaaagtggcttacccagggttgggccaccgcggcattgtttaatctgaaactg
ccgatgaaacgccgattccaagaaacgtggcaattgttggaaaaactgactgcggccatg
gagcgcatggatcacctgggtgagccggtaattaaggccgcgcacctgtattacgatcgt
gaagagattaccgtctgggccagctttcatcggagctactga

DBGET integrated database retrieval system