KEGG   Alcanivorax borkumensis: ABO_1567Help
Entry
ABO_1567          CDS       T00380                                 

Gene name
fadA
Definition
(GenBank) Acetyl CoA acetyltransferase (thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00071  Fatty acid degradation
abo00072  Synthesis and degradation of ketone bodies
abo00280  Valine, leucine and isoleucine degradation
abo00310  Lysine degradation
abo00362  Benzoate degradation
abo00380  Tryptophan metabolism
abo00620  Pyruvate metabolism
abo00630  Glyoxylate and dicarboxylate metabolism
abo00640  Propanoate metabolism
abo00650  Butanoate metabolism
abo00900  Terpenoid backbone biosynthesis
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01120  Microbial metabolism in diverse environments
abo01130  Biosynthesis of antibiotics
abo01200  Carbon metabolism
abo01212  Fatty acid metabolism
abo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABO_1567 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_1567 (fadA)
   00640 Propanoate metabolism
    ABO_1567 (fadA)
   00650 Butanoate metabolism
    ABO_1567 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABO_1567 (fadA)
   00072 Synthesis and degradation of ketone bodies
    ABO_1567 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABO_1567 (fadA)
   00310 Lysine degradation
    ABO_1567 (fadA)
   00380 Tryptophan metabolism
    ABO_1567 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABO_1567 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABO_1567 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABO_1567 (fadA)
Enzymes [BR:abo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABO_1567 (fadA)
Exosome [BR:abo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABO_1567 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAL17015
UniProt: Q0VP83
Position
complement(1789422..1790633)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDAIRTPRGRGKKDGSLHTVKPLDLVVGLIDEVKDRFPNMDTNSIDDVLLGVVT
PVGDQGACIAKTAALAAGLPDTVAGLQMNRFCASGLEAVNTGAQKVASGWDDLILAGGVE
SMSRIPMGSDGGAWAMDPITNYKTGFVPQGIGADLIATLEGWSRRDVDEFAAESQARAVN
AWEKGYFDKSVVPVKDINGMTVLDRDEHVRAGTTADALAGLNPSFAMMGEMGGFDAVALQ
KYHWVEKINHVHHAGNSSGIVDGASLLVLGNEKVGKDFGMKARGRIVSTAISGADPTIML
TGPGPAAKKALAKAGLKASDIDLWEINEAFAAVAMRFMKDMDITPDVTNVNGGSIAMGHP
LGATGAMIVGIALDELERRDKKFALCTLCVGGGMGIATIIERL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgatgccattcgtactccccgtggtcggggtaagaaagat
ggctctttgcatacggttaagccgctggatctcgtagtaggcctgatcgatgaagtaaaa
gatcgttttccaaatatggataccaatagcattgatgatgtgctgttgggtgtggtgact
ccggtcggtgaccagggtgcctgtattgccaaaacagcagctctggctgctgggttgcca
gatactgtagcgggtttgcagatgaaccgtttctgcgcctctggcctggaagcagtgaat
accggtgcccagaaagtggcctccggttgggatgacctgattctcgccggtggtgtggaa
tccatgagccgtatccccatgggctctgacggtggtgcctgggcaatggacccgatcacc
aactacaagactggctttgttccccaggggattggcgcggatctgattgccactctcgaa
ggctggagccgccgtgatgtggacgaatttgctgctgagtcccaggcccgtgctgtgaat
gcgtgggaaaagggttatttcgataaatctgtggtgccggtgaaagacattaacggcatg
acagtgctggatcgtgacgagcacgttcgcgcgggcaccactgctgatgcgctggcaggc
ctgaacccgtctttcgcaatgatgggcgaaatgggcggttttgatgcggttgctttgcag
aagtatcactgggtggaaaagattaaccacgttcaccacgcaggtaactcctccggtatc
gtggatggtgcttctctgctggtgctgggtaacgaaaaagtgggcaaggacttcggcatg
aaagcccgtggccggattgtcagcaccgcgatcagtggtgccgatcccaccatcatgttg
acgggcccaggtccggcggctaagaaagcgctggcgaaagccggcttgaaagccagcgat
attgatctgtgggaaatcaacgaagcctttgcggcggtcgccatgcgctttatgaaagac
atggacatcaccccggacgttaccaacgtcaatggtggctccatcgccatgggccacccg
ttgggagctactggcgccatgattgtgggtattgcactggatgaactcgagcgccgcgac
aagaagttcgcattgtgcaccctgtgtgtgggcggtggcatgggtatcgctaccatcatc
gagcgtctgtaa

DBGET integrated database retrieval system