KEGG   Alcanivorax borkumensis: ABO_1838Help
Entry
ABO_1838          CDS       T00380                                 

Gene name
pheS
Definition
(GenBank) Phenylalanyl-tRNA synthetase, alpha subunit
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:abo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABO_1838 (pheS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abo01007]
    ABO_1838 (pheS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abo03016]
    ABO_1838 (pheS)
Enzymes [BR:abo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     ABO_1838 (pheS)
Amino acid related enzymes [BR:abo01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   ABO_1838 (pheS)
Transfer RNA biogenesis [BR:abo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ABO_1838 (pheS)
 Prokaryotic Type
    ABO_1838 (pheS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N
Motif
Other DBs
NCBI-ProteinID: CAL17286
UniProt: Q0VNG2
Position
complement(2107917..2108936)
Genome map
AA seq 339 aa AA seqDB search
MENLNALVDAALAEVEQAGDIRALDDVRVKYLGKKGEISALMKGLGKLSAEERPQAGAVI
NEGKQKVQDAIADRKSAMEEAALKQQLASETVDVTLPGRGELPGGLHPVNRMRRRIEDFF
LRLGFDISEGPEVEDDFHNFEALNIPSHHPARAMHDTFYFGDGRLLRTHTSPVQVRVMEQ
GKPPFRIIAPGRVYRCDSDLTHTPMFHQVEGLLVDKGITFADLRGTVAEFLRYTFEVEDL
PVRFRPSYFPFTEPSAEVDVGCVSCGGEGCRVCSHTGWIEIMGCGMVHPTVLEAGGVDAE
EYSGFAFGMGIERIAMLRYGVNDLRLFFENDTRFLSQFG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatctcaatgccctggtcgacgctgctctggcagaggtcgaacaggctggcgac
attcgggccttggatgatgtgcgggtaaagtacctgggcaagaagggcgaaatcagtgcc
ctgatgaaaggcttgggtaagctgagcgctgaggagcgcccgcaggcgggtgcggtgatc
aatgaaggcaagcaaaaagtccaagacgccattgccgatcgtaagagtgcaatggaggaa
gcggcgttaaaacagcagcttgccagtgaaaccgttgatgtcaccctgccggggcgtgga
gagttgccgggtgggttgcatccggtaaatcgtatgcgccgtcgcattgaagatttcttc
ctgcgtttgggctttgacatttccgaaggcccggaagtggaagacgatttccacaatttt
gaagcgttgaatatccctagccatcacccggcccgggccatgcatgacaccttttacttt
ggtgatgggcgtttgttgcgtacccatacctcaccggtacaggtgcgggtgatggagcaa
ggcaagcccccgttccggattatcgccccgggtcgagtgtatcgttgtgattcggatctg
acccatacccccatgttccaccaggtggaaggtctgttggtagacaagggcataaccttt
gcggacctgcgtggcaccgtggcggaattcctgcgttacacctttgaagtggaagatctg
ccggtgcgtttccgtcccagctattttccgtttaccgagccaagcgccgaagtcgatgtg
ggctgtgtcagctgtggtggagaaggctgccgggtgtgttcgcacacaggttggatcgaa
atcatgggctgcggcatggtgcacccaacggtgcttgaggccggcggcgttgatgcagaa
gagtacagcggttttgcgtttggtatgggcatcgaacgtatcgccatgctccgttatggc
gtaaacgatttgcggttgttctttgagaacgacacccgctttttgtcccagtttggctaa

DBGET integrated database retrieval system