KEGG   Alcanivorax borkumensis: ABO_1864Help
Entry
ABO_1864          CDS       T00380                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00230  Purine metabolism
abo00240  Pyrimidine metabolism
abo01100  Metabolic pathways
abo01110  Biosynthesis of secondary metabolites
abo01130  Biosynthesis of antibiotics
Module
abo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
abo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
abo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABO_1864 (ndk)
   00240 Pyrimidine metabolism
    ABO_1864 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:abo04131]
    ABO_1864 (ndk)
Enzymes [BR:abo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     ABO_1864 (ndk)
Membrane trafficking [BR:abo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    ABO_1864 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CAL17312
UniProt: Q0VND6
Position
complement(2139996..2140427)
Genome map
AA seq 143 aa AA seqDB search
MAVERTLSIIKPDAVAKNVIGEIVTRFEKAGLSVVAMKMVHLSDEKAGGFYAEHKERPFF
KDLVGFMTSGPVVVQVLEGEDAVAKNRDLMGATNPKEAEAGTIRADFAETIDANAVHGSD
STESAAREVAYFFSDEEVCPRAS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgagcgcacactctctatcatcaagcctgatgccgtggccaagaacgtgatc
ggcgaaatcgttacccgtttcgaaaaggctggcctgagcgtggttgccatgaaaatggta
cacctgagcgacgaaaaagcgggcggcttctatgctgagcacaaagagcgtcctttcttc
aaggatctggtgggcttcatgaccagcggtcctgtggttgtacaggtgctggaaggtgaa
gatgcggttgccaaaaaccgtgacctgatgggtgctaccaacccgaaagaagcggaagct
ggcactatccgtgcagattttgcggaaactatcgacgcaaacgcggtccatggttctgac
tccaccgagtctgctgcccgcgaagtggcctatttcttctccgatgaagaagtgtgcccg
cgcgctagctaa

DBGET integrated database retrieval system