KEGG   Alcanivorax borkumensis: ABO_2334
Entry
ABO_2334          CDS       T00380                                 

Gene name
xerC
Definition
(GenBank) integrase/recombinase XerC
  KO
K03733  integrase/recombinase XerC
Organism
abo  Alcanivorax borkumensis
Brite
KEGG Orthology (KO) [BR:abo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abo03036]
    ABO_2334 (xerC)
Chromosome and associated proteins [BR:abo03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ABO_2334 (xerC)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 DUF3435 Phage_int_SAM_5 Integrase_1
Other DBs
NCBI-ProteinID: CAL17782
UniProt: Q0VM16
Position
2661121..2662044
AA seq 307 aa
MDSDSHNTLQTVNTFLTHLASERRLSPHTVNGYQRDLIEARTLLGSQPWDTLTVHDMRSL
AASLHRQGKSGKTIQRMLSTLRTFFRYLMREGLARDNPAIDIRAPKSGKRLPKALDVDQV
SHLLDAGTSNSEPLALRDQAIMELLYACGLRLAELLSLNLDSIDLHESQLLVTGKGNKTR
QLPVGKPALTAVRRWLQVRPMLIKSSDQNALFISKNGRRLSPSSVQQRLKRHALERGLDA
HLHPHKLRHSFATHLLESSGDLRAVQELLGHADLATTQVYTHLDFQHLAQVYDGAHPRAQ
RRKDDDE
NT seq 924 nt   +upstreamnt  +downstreamnt
gtggatagcgatagccataacacactgcaaacggttaacaccttcctaacccacttggcc
agcgagcgtcgcctctcaccgcacaccgtaaacggctatcaacgggacctgatcgaagcc
cgaacattactcggcagccaaccctgggacaccctcaccgtccacgacatgcgcagcctc
gccgcctcgctacaccgccaagggaaaagcggcaaaactattcagcgcatgctttccacc
ctgcgtacgtttttccgttacctgatgcgtgaagggcttgcccgcgacaacccggccata
gacattcgcgccccgaaaagcggtaaacgcctgcccaaagcactggatgtagatcaagtc
agccatttgctggatgccggcaccagcaacagcgaacccctagccctgcgcgatcaagcc
ataatggaactgctctatgcctgcggcctgcgtttggccgaactgcttagcctaaaccta
gacagcattgatctgcatgaaagccaactgttggtcaccggtaaaggcaacaagacccgg
caactaccagtgggaaaacccgccctcaccgccgtgcgccgctggttgcaagtgcgtccc
atgctgatcaaaagcagcgaccagaacgctctttttatcagcaaaaacggccggcggctg
tctccttccagcgtacaacagcggcttaaacgccatgctctggagcgggggctcgatgcc
catctacatccgcacaaattacgccactccttcgccacacacctgctggaatcctccggc
gacttgcgggcagtgcaggaactgctcggccacgcagacttggccaccacccaggtttac
actcacctggatttccaacacttagctcaggtctacgacggagcacacccaagagcccag
cgccgcaaggacgatgacgaataa

DBGET integrated database retrieval system