KEGG   Alcanivorax borkumensis: ABO_2619Help
Entry
ABO_2619          CDS       T00380                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
abo  Alcanivorax borkumensis
Pathway
abo00670  One carbon pool by folate
abo01100  Metabolic pathways
abo01120  Microbial metabolism in diverse environments
abo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ABO_2619 (metF)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ABO_2619 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: CAL18067
UniProt: Q0VL81
Position
2964020..2964847
Genome map
AA seq 275 aa AA seqDB search
MKRISFEFFPPKTDQGKEKLLATQQKLLVKNPAFFSCTFGAGGSTRDNTRDTVNKLREQH
GDTAPHLSCIGQSREEILELVNGYKEAGVQRIVALRGDLPSGMGYAQSEIKYADELVQLI
RQETGDHFTLEVAAYPEMHPQARSFEDDIAHFKRKVDAGANSGLTQYFYNADAYGYYMDA
LQKIDCDAPVYPGIMPILNVANLLRFSNTCGADVPRWLQSKLNDIKDDDAAVKAFGEEVV
TRLCERLLAMGAPGLHFYTMNQAGPNLRILDNLGM
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcagttttgaattctttccgccaaaaaccgaccaggggaaagaaaagcta
ctggcgacgcagcaaaaactgctggtcaagaaccccgcgtttttttcctgcacctttggt
gctggtggctccacccgtgacaatacccgcgacaccgtcaataagttgcgcgagcaacac
ggcgacaccgcaccgcatctgagctgcatcggtcagagccgcgaagaaatcttggagctg
gtcaacggctacaaagaagccggcgtgcaacgcatcgttgccctgcgtggcgacttacct
tccggcatgggttacgcccagagcgagattaaatacgccgacgaactggtgcaattgatc
cgccaggaaaccggcgatcacttcaccctggaagtggcagcctacccggaaatgcacccg
caagcgcgcagcttcgaagatgatattgcgcacttcaaacgcaaagtagatgccggcgcc
aacagcggcctaacccagtatttctacaatgcagatgcctacggctattatatggatgcg
ttacaaaagattgactgtgacgctcctgtctaccccggcatcatgcccattctcaacgtg
gccaacctgttacgcttttccaatacctgtggcgccgatgtgccacgctggctgcaaagc
aagcttaacgacatcaaggatgatgacgccgcagtgaaagcattcggtgaagaagtggtt
acccgtttatgcgagcgactgctggccatgggcgcaccgggcttgcacttctacaccatg
aaccaagccggccccaaccttcgtattctcgacaatctggggatgtga

DBGET integrated database retrieval system