KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT104127Help
Entry
AGABI1DRAFT104127 CDS       T03136                                 

Gene name
AGABI1DRAFT_104127
Definition
(RefSeq) hypothetical protein
  KO
K14848  ribosome assembly protein RRB1
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abp03009]
    AGABI1DRAFT104127 (AGABI1DRAFT_104127)
Ribosome biogenesis [BR:abp03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    AGABI1DRAFT104127 (AGABI1DRAFT_104127)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1C_H4-bd WD40
Motif
Other DBs
NCBI-GeneID: 18821955
NCBI-ProteinID: XP_007325842
JGI: Agabi_varbur_1_104127
UniProt: K5WBB4
Position
Unknown
AA seq 507 aa AA seqDB search
MSVTIQLPEGAGEPFKKASSSGQRRESEAVDEMGEFEDNWEDEIESDEDAVDAEAEDKDG
MEVDEVLPAIEESEEPQPAKEAYIPGHHTLGKDEILEADDSVYIMRHTLGVDWPCLSFDV
LRDNLGDERQRYPTTAYIVGGTQADIAKHNELIVYQMSSLHKTQHDNADSDEEDDDDEDA
LDEDAVLDYRSIPHPGGVNRTRAQPLPAGSSLPPTTQPYLVATWAETGKVHIWNVRQLIE
SLTVPGYVYNKAQAQTPVFTINSHGRTEGFAMDWASSGSSSLRLLTGDNHSKIYLTTSTP
SGFNALSQPFVSHTSSVEDIQWSLSEPTIFASCSADQSIQIWDVRTKGRKSVAGIMQAHE
SDVNVISWNRTTTNLLVSGGDDGGIKAWDLRNVKKKGSGEPDPTPVAHFAWHSKPITSIE
WHPTEDSIFAASGADDQVTLWDLAVEHDTEEMGMDDTNAGEKEVPPQLLFVHQGQEDIKE
VHWHPQIPGTVISTASDGFNIFKTISV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttactatccaactccccgaaggggccggagagccctttaaaaaggcctccagt
agtggccaacggagagagtctgaagccgtcgatgagatgggagagtttgaagacaattgg
gaagacgagatcgagagcgatgaagacgcagtagatgctgaagctgaagataaagatggg
atggaggtggatgaagtacttcccgcgattgaagagtctgaagaaccgcaacctgcaaaa
gaagcgtatattcctggtcaccatactctaggaaaggacgaaattctcgaagcagacgac
tcagtttatattatgcgacatactctgggcgtggactggccctgtctatctttcgatgtt
cttcgggataatctaggtgacgaacgacagagataccctacgacagcctatattgtaggt
ggtacacaagccgatatcgcaaaacataatgagcttattgtttatcaaatgagttctctg
cataaaacacagcatgataacgcggattctgacgaagaagacgatgacgatgaagatgct
cttgacgaggatgctgttctagattacagatccattccccatcccggcggtgtaaaccga
acgcgtgctcaacctctgcctgcaggtagttccctaccccctactacccaaccttacctt
gtcgcaacctgggcggaaaccggcaaagtgcacatctggaacgtcagacagttaattgaa
tctctaacggtacccggttatgtgtacaataaagcacaagcacagacgcctgtgtttacc
ataaattcgcatggacgtaccgagggtttcgctatggattgggcatcgtctggttcatcc
tcgttacgattattgacgggtgataaccattctaaaatatatctgacaacctcaacgcct
tctggtttcaatgccctctcccagccattcgtatcacatacatcgagtgtcgaggatatc
caatggagtctatcggaacccaccatcttcgcatcttgttctgcagaccagagcattcaa
atttgggatgtacgtacgaaaggacgcaaaagtgtggctgggataatgcaagcccatgaa
agcgatgtgaacgttatcagttggaatcgtacaacaacaaatctccttgttagtggtggt
gacgatgggggaatcaaggcttgggatctgagaaatgtcaagaagaaaggttccggagag
ccagacccaaccccagtggctcattttgcgtggcacagtaaacccattacctcaattgaa
tggcacccgactgaggattcgatctttgccgcgtctggtgctgacgaccaagtgacgctt
tgggatctggcagtcgagcacgacacggaagagatgggtatggatgacacgaatgctgga
gaaaaagaggttccccctcagcttctgtttgtccaccagggccaagaagacattaaggaa
gtgcattggcatcctcagataccgggaaccgtgatcagtacagcatccgacggatttaac
atattcaaaaccatatctgtctaa

DBGET integrated database retrieval system