KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT112120Help
Entry
AGABI1DRAFT112120 CDS       T03136                                 

Gene name
AGABI1DRAFT_112120
Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00330  Arginine and proline metabolism
abp00360  Phenylalanine metabolism
abp00380  Tryptophan metabolism
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AGABI1DRAFT112120 (AGABI1DRAFT_112120)
   00360 Phenylalanine metabolism
    AGABI1DRAFT112120 (AGABI1DRAFT_112120)
   00380 Tryptophan metabolism
    AGABI1DRAFT112120 (AGABI1DRAFT_112120)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AGABI1DRAFT112120 (AGABI1DRAFT_112120)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase DUF5444
Motif
Other DBs
NCBI-GeneID: 18823518
NCBI-ProteinID: XP_007327703
JGI: Agabi_varbur_1_112120
UniProt: K5Y254
Position
Unknown
AA seq 554 aa AA seqDB search
MLRLHYLTCIVVFFLFGDVFAGLVNTRGGTRAFPDLYEASVDELQEGLDAGTFTSVDLVT
AYFARIDEVNLKGPALRAVLELNPMALSQAADLDRERRATGKRGHLHGIPILLKDNIATV
ASEGMNTTAGSFSLLGSIVPDDAGVVKRLRRAGAIILGKANMSEWAHFRGNLPSGWSGRG
LQCTNAYFPNADPCGSSSGSGVGASIGLAAVTLGTETDGSITCPSSNNNLAGIKPTVGLT
SRAGVIPISAHQDTIGPMTRSIADAAIVLSVIAGKDPNDNFTLAQPDRVPDYTRALRKDA
LRGKRIGVPRHVFLNNSISGDDPSINVAFEQALNVIRRLGATVVDPADIPSAEEIVRSNN
ETVVLDTEFKVQLNQWFESLIENPSGVRSLADLIQFDDDNPDLEEPPQFTDQSQLIEAQR
TQGFDDAYFTALAFNEDLGATRGIDAALKRHKLDALVLPATGFTTVPAAIVGYPIVTVPL
GFFPDNVPIGRAGPNLVYPAPGVPFGLSFFGTAFSEFDLIGFGYAYEQATKTRLARRAFP
DAIPKTQLEDVVRN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcttgcattatctgacttgcatagttgtatttttcctgttcggggacgtattt
gccggccttgtgaacactcgaggtggcacgagagcatttcctgacctctacgaggcctcc
gtggatgagcttcaagagggactagatgctgggacatttaccagtgtcgacctcgtcacg
gcctactttgctcgcatagatgaagtcaatctaaagggtccagcattgcgtgcagtgctc
gagttgaatcctatggctctatctcaagctgctgacttggatcgtgagcggagggcaaca
ggcaaacggggccacctgcatggaattcctatactgctcaaagacaatattgccacggtt
gcttcagaaggcatgaacacgactgcgggttctttcagtctccttggttcgatcgttcca
gatgatgctggtgtggtcaagcggcttaggagagcgggagctatcatacttggcaaagca
aatatgtcggagtgggcacatttccgaggcaatttaccttctggttggtccgggcgcggt
ctccagtgcacgaatgcatatttcccaaatgccgacccttgcggctcatcctctggttcg
ggtgttggtgcatctattgggcttgcagctgttacacttggaacagagacagatggaagt
attacgtgtccttccagtaataataatctagcgggtatcaagccgaccgttggattgacc
tctcgggcaggagtcataccaatctccgcacaccaagatactattgggcctatgacgaga
tcgatcgctgatgccgccattgtgttatccgtaattgcgggaaaggacccaaacgacaat
ttcaccctcgctcaacccgatcgagttcctgattatacccgggcgctgaggaaggatgct
ctgagaggaaagcgaattggggtccctcgacacgtattcctgaataactcaatatctggc
gatgatccttcaataaatgttgcctttgaacaagcccttaacgttatccgtagactcggt
gcgacagtggtggatcctgcagacatcccttctgccgaagagattgtcaggtcgaataat
gaaaccgtcgttcttgacaccgagttcaaagttcaactaaaccaatggtttgagtctctt
atcgaaaatccgtccggagtccgcagccttgcagatctcattcaattcgatgatgataat
cctgaccttgaagagccacctcaattcacagaccaatcacagctcatcgaggcacaacgt
acacaaggtttcgatgatgcctattttactgcactcgccttcaacgaagatctcggagcg
acacggggcatcgatgccgctcttaaacgccataagcttgacgcattagttcttccggct
actgggttcactaccgttccggcagccattgttggatacccgatcgttactgttcctctt
ggtttcttcccggacaatgttccaattggacgcgctgggcctaatctcgtttaccctgca
ccaggtgttccgttcggactttcgttctttggaactgcattttctgaattcgacttgatc
ggtttcggctatgcgtatgaacaagcgacaaagactcgattggcgagaagggccttccca
gatgctattcctaagactcaattggaagacgttgtccggaattag

DBGET integrated database retrieval system