KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT113097Help
Entry
AGABI1DRAFT113097 CDS       T03136                                 

Gene name
AGABI1DRAFT_113097
Definition
(RefSeq) hypothetical protein
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:abp03041]
    AGABI1DRAFT113097 (AGABI1DRAFT_113097)
   03110 Chaperones and folding catalysts [BR:abp03110]
    AGABI1DRAFT113097 (AGABI1DRAFT_113097)
Enzymes [BR:abp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AGABI1DRAFT113097 (AGABI1DRAFT_113097)
Spliceosome [BR:abp03041]
 Complex C
  Other components
   PPlases
    AGABI1DRAFT113097 (AGABI1DRAFT_113097)
Chaperones and folding catalysts [BR:abp03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AGABI1DRAFT113097 (AGABI1DRAFT_113097)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1
Motif
Other DBs
NCBI-GeneID: 18823880
NCBI-ProteinID: XP_007329146
JGI: Agabi_varbur_1_113097
UniProt: K5X9V0
Position
Unknown
AA seq 448 aa AA seqDB search
MSVLFETSLGDIVIDLETESCPKTCENFLKLCKVYYYNLNAFFNVSKDFLAQAGDPTATG
TGGESVWSYLASTSSNKSSNEAKEPRYFTPEFRPKLKHAKRGTVSMAVAPAIDASGKEMQ
GGCGSQFFITLGDNVDYLDGKHAVFGHVVEGEDTLEKINEVFVDQDSRPYKDIRIRHVIV
LDDPFPDPPGLIKPPSSPTRPPDNSTRIAEDEDPLFQLPEEEEERIRREKAAAASALTLE
MVGDLPFANVRPPENVLFVCKLNPVTRDEDLELIFSRFGTIMSCQVIRDKKTGDSLQYAF
IEFDKRDDAEQAYFKMQNVLVDDRRIWVDFSQSVARMNNQWSNDIKRGKPSRVGEGFGGR
ADLERTKRYRVDDTARHGSDGYGMVFDVPGHQSKRRKHRSRSRDRGDRTRHESSMSPRDR
HREEDRHRERDRDRRRDRSHDRDIQRRR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttttgtttgaaacatctttgggggacattgtgatcgacctcgagacggagtca
tgtccaaaaacctgcgaaaacttccttaagttatgcaaagtgtattattataacctgaat
gccttctttaatgtttcaaaagattttctggctcaagctggcgatccaaccgctacaggt
acaggcggtgaaagtgtctggtcatacctcgcatccacatcttccaacaagtcttcaaat
gaagcgaaggagccgcgttacttcacacccgagtttcgtccaaagctcaaacatgcaaaa
cgtggcactgtctcgatggctgtggctccagctatcgacgcgtcgggcaaggaaatgcaa
ggtggatgtggtagtcagttcttcattacgttgggcgacaatgtggactaccttgatggc
aaacacgcagtctttgggcatgtcgtagagggtgaggacacgttggagaaaatcaatgaa
gtctttgtggatcaagactctcgtccctataaggacattcgaataagacatgttatcgtc
cttgacgacccatttccagatccaccaggcctcatcaaaccaccttcctctccaactcgc
ccccctgacaattcgactcgtatcgctgaggatgaggacccgcttttccaactcccagaa
gaagaggaggaacgtatccggcgtgaaaaagcggctgcggcatcagctctcacccttgaa
atggtcggagaccttcctttcgccaatgtccgccctcctgaaaatgttctattcgtctgc
aaactcaatcctgtgactcgggatgaagatttagagctaatattttcccggtttggaact
atcatgagctgtcaagtaattagggacaagaaaacaggtgattcgctgcagtacgcattc
atcgagtttgacaaaagggatgatgctgaacaggcttatttcaagatgcaaaacgtttta
gtggatgaccgtcggatctgggtagatttctcacagtccgtggctcggatgaataaccaa
tggtccaatgatatcaaaaggggtaaaccgagcagagtgggtgaaggatttggcggtcgg
gctgacctcgaaagaacaaaacgatatcgcgttgatgataccgcgcgtcacggaagtgat
gggtatgggatggtctttgacgttcccggtcatcagtctaaacgccggaagcatcgaagt
cgaagccgcgatcgtggtgacagaacaagacatgagagctcaatgagtcctcgagacagg
catagagaggaagatcgacatcgcgaaagagacagggataggcggagagacaggagtcat
gatagagatatccagaggagacggtga

DBGET integrated database retrieval system