KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT113984Help
Entry
AGABI1DRAFT113984 CDS       T03136                                 

Gene name
AGABI1DRAFT_113984
Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00010  Glycolysis / Gluconeogenesis
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGABI1DRAFT113984 (AGABI1DRAFT_113984)
Enzymes [BR:abp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     AGABI1DRAFT113984 (AGABI1DRAFT_113984)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C UPF0767
Motif
Other DBs
NCBI-GeneID: 18824174
NCBI-ProteinID: XP_007330084
JGI: Agabi_varbur_1_113984
UniProt: K5X8S3
Position
Unknown
AA seq 592 aa AA seqDB search
MSAQPTSKALQGEVNRLKLELHTMHTERGTSEITVANYILTRLVQLGVTKMFGVPGDFNL
AFLDLVEDHKSIDWVGNCNELNAAYAADGYARVKQTSLGVVTTTFGVGELSAMNGIAGAF
SEMVPVLHLVGVPSTTQQKARPILHHTLGDGRYDAYTIASQQFTIMQTSLNKDSDVARLI
DDTLVACITRARPVYMTLPTDMVYEHISAERLKIPLARHPAINDVETEDFVLDVIEERVK
EAGGDVIILVDACVIRFEVQDEVNDLLRSTGFPVYATPMGKTAIDESYERYGGVYIGSIT
QPLVKERVESAKLILSIGLLSSDFNTGNFSYNIPIRRLIELHSDHTRIQYALFQGVGMKQ
LLPKLTERLKQFHANASKIPVEPFTSMVPKSMGGDETIVHSHFWPRVGQFFQPKDVIITE
TGTANFGIMNIPLPDGAKLVSQILWGSIGWSVGSALGAAFAARETGKNRVILFVGEGSLQ
LTVQELSPMIRHGLTPILFVINNAGYTIEKFIHGKYRKYNNVDNWKWTGLLDTFGCNSGK
PSKSYTVSTRTELDRLLNNEEFGAAKQIQLVEVVMPALDAPDVLTQTAGQKA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcagccaacatccaaagctcttcagggcgaagtcaatcgactgaagcttgag
ctgcatactatgcataccgaacgtgggactagcgaaatcactgttgcgaactacatcctt
actcgtctggtgcagcttggtgttacgaaaatgtttggcgtgcctggagactttaacctt
gctttcttggatctcgtcgaagaccacaaatcgattgactgggtcggcaattgtaacgaa
ctcaatgcagcttatgcagccgatggttatgctcgcgttaagcagacctcacttggtgtt
gtaaccactactttcggtgtcggcgagctttctgctatgaatggtattgccggggccttt
tccgagatggtccctgttctgcatcttgttggtgttcctagcaccacgcaacagaaggca
cgacctatcttacaccacacccttggcgatggcagatacgacgcttatacaattgcttcc
cagcaatttaccatcatgcagacaagtctgaacaaggacagtgatgttgcgcgtctcatt
gatgacacccttgttgcgtgcatcactagggcgcggcctgtatatatgacactccccact
gacatggtgtatgagcacatttcggctgaacgactcaaaatccctctagcgcgccatcca
gcaatcaatgacgttgagactgaggacttcgtgcttgatgtgatcgaagagcgagtcaaa
gaggcgggtggcgacgtgattatccttgtcgacgcctgcgtcattcgtttcgaagttcaa
gatgaagtcaacgatctattgaggtctaccgggttccctgtctatgcgacgcctatgggt
aaaactgcgattgacgaaagttacgagcgatatggaggggtttatattggaagcatcaca
caacctctagtcaaggaaagggttgaatcagcgaaactgatcctgtcaattggtcttctc
tcgtcggacttcaatactggcaatttctcatacaacatccccattcggcgcctcattgaa
ctgcattccgaccatacgaggatccaatatgcccttttccaaggagttggaatgaaacag
ctgctaccgaaactcactgaacgcctgaaacaattccatgcgaacgcgagtaagatccct
gttgaacctttcacttccatggtacccaaatccatgggtggtgatgagacgatcgtccac
tctcacttctggccgcgggtaggtcaatttttccaacccaaggatgtcataatcacagag
actggtaccgcgaactttggtatcatgaatattcctctaccggacggagcgaaactagtt
agtcaaattctttggggtagtattggttggtctgtgggaagtgctctcggtgccgctttc
gctgcgcgagaaactggtaaaaatagggttatcttattcgtcggtgaaggcagtttgcaa
ctcaccgtgcaagagttatcaccaatgattcgacatggtttaacacccattttatttgtg
atcaataatgctggatatacaattgagaagtttatccatggcaaatatagaaaatacaac
aatgttgacaattggaagtggacaggccttttggacacgtttggttgtaattcgggcaag
ccttctaaatcgtacaccgtcagcacgcgcacggagttggatcgtcttttgaacaatgaa
gaatttggcgcagcaaaacagatacagctggtagaggtagtgatgccagcattggatgcg
cctgatgttcttacgcagacagcgggccagaaggcgtag

DBGET integrated database retrieval system