KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT114233Help
Entry
AGABI1DRAFT114233 CDS       T03136                                 

Gene name
AGABI1DRAFT_114233
Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:abp03021]
    AGABI1DRAFT114233 (AGABI1DRAFT_114233)
Transcription machinery [BR:abp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     AGABI1DRAFT114233 (AGABI1DRAFT_114233)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 18824256
NCBI-ProteinID: XP_007330474
JGI: Agabi_varbur_1_114233
UniProt: K5XU83
Position
Unknown
AA seq 376 aa AA seqDB search
MAQAQGRDLEREVFGGSDSELSTDDEEELQLPRPSVPRPKSPQHELAESSGSDSEDDYVQ
DNRNIGKAKKRIPGRRKRTADDGEERPVQRKRKRKSPVEIDLSELPPEQASKIRLDMQIE
AILKPKKTSRPRKKKGGDEVLDSFADDEVARLREAMLHAADEDIRANEEKLPATAKLRML
SEAMETLRKASLAQSIIDNNLLEAVRRWLEPLRDKSLPALNIQRELFFSIRKMEFIDTAV
LKESQLGRVVLFYTKCKRVTPDIARIANHLVSTWSRPIIKRSASYRDRVVPIAALAEDGV
PKEHLNTILAKLKDEERGRVRKHTVQVPHAVIGDYTIAPRATTGFSRPNVSVDMDIERRR
KNNEMLRSFTRRVANK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcccagggccgcgatctagaacgcgaggtattcggtggctcagactcggag
ctctccacagacgacgaagaggagctccagctcccccgtcccagcgttcctcgccccaag
tctcctcagcatgaactcgcagagtcgtctgggtcagactccgaggacgactatgtccaa
gataatcgtaacataggcaaagccaagaaacgcatcccaggcagaagaaagcgcacagca
gacgatggcgaagagcgaccagtccagcgcaagagaaaaagaaagtcacccgtcgagata
gacctcagcgagctgccccccgagcaagcatccaagatacgacttgatatgcaaattgag
gctattttgaaacccaaaaagacatcacgtccgcgcaaaaagaagggcggtgatgaagtt
ttggacagttttgccgatgatgaggtagcccgacttcgtgaggccatgttacacgcagcg
gacgaggatatccgtgcgaacgaggaaaaacttcctgcgacggctaaactgcgcatgctg
tccgaagcaatggaaactcttcgaaaggcatcactggctcaatccatcattgacaacaac
cttttggaagcagtgagacgatggctcgagcctcttcgtgacaaatctctgccagcgctc
aacattcagcgagaactcttcttcagtattcgcaaaatggaatttattgatacggccgtg
ctcaaggaatctcaactcggccgcgtcgttttattctacacaaagtgcaaacgcgtcacg
ccagatatagcacgtatcgccaatcacctagtgtcgacatggtctaggcctatcatcaaa
cggtcggcttcgtatagggaccgtgttgtacctattgccgcccttgcggaagatggagtg
ccaaaagaacatctcaatactatcctggctaaactgaaagacgaggaaaggggccgtgtc
aggaagcatactgtccaggttccccatgcagtgattggagactatactattgcgccccga
gccaccactggtttttcaaggccgaatgtcagtgttgatatggatatcgagaggaggagg
aagaacaatgagatgttgaggagctttaccagaagggttgctaataaatga

DBGET integrated database retrieval system