KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT119334Help
Entry
AGABI1DRAFT119334 CDS       T03136                                 

Gene name
AGABI1DRAFT_119334
Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00350  Tyrosine metabolism
abp00360  Phenylalanine metabolism
abp00380  Tryptophan metabolism
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AGABI1DRAFT119334 (AGABI1DRAFT_119334)
   00360 Phenylalanine metabolism
    AGABI1DRAFT119334 (AGABI1DRAFT_119334)
   00380 Tryptophan metabolism
    AGABI1DRAFT119334 (AGABI1DRAFT_119334)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    AGABI1DRAFT119334 (AGABI1DRAFT_119334)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abp04147]
    AGABI1DRAFT119334 (AGABI1DRAFT_119334)
Enzymes [BR:abp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     AGABI1DRAFT119334 (AGABI1DRAFT_119334)
    4.1.1.105  L-tryptophan decarboxylase
     AGABI1DRAFT119334 (AGABI1DRAFT_119334)
Exosome [BR:abp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGABI1DRAFT119334 (AGABI1DRAFT_119334)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18825551
NCBI-ProteinID: XP_007328364
JGI: Agabi_varbur_1_119334
UniProt: K5XCC6
Position
Unknown
AA seq 516 aa AA seqDB search
MDIEQFRKAGYNAIDRICDYYYNLQSMPVKSSVSPGYLAQHIPTNPPEQGEPWQQILDDY
TEHIIPGLTHWQHPSFYGYFPTACSFPGILADLLASSTPNPGFNWSCSPACTELEALMMD
WAADLLGLHKEFFNSSNKGGGVIQTTASDSALVAVVAARSRYQRLHPDVLFKDLIIYTTT
QTHSLGLKAGLILGIGVRAIEVDAHDKYALRGSTLRKTLEDDAADGKHPFILIATLGTTS
SGASDNMPEIRNIAKDYPSLWIHVDAAWAGVVFSCPEYRDKLYHTDINEMATSFCTNFHK
WGLVNFDCSAFWVRDRSLLTEALDITPPFLRTKEGDSGQVVDYRNWHLALGRRFRSLKMW
FVFRTYGVDGFQGYIRRCIGLNTLFQEKINETSSLLELVTTPSLSLSVIRISPAALSPSS
SSSDSTDLSTQDFMNTLNQTFYSRLSARNDIFLTQTILNGAFCIRFSIGAELTTEDDICR
AVDTLIEEAKNVVEELRVKNDKTEQSIANGSVSAGV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgaacaattcagaaaggcaggatacaatgccatagatcgcatatgcgactac
tactataacctccaatcgatgcccgtcaagtcttctgtctctccgggatacctcgctcaa
catatccccacaaacccaccagaacaaggcgaaccatggcaacagatacttgacgattac
accgaacacatcatacccggtctcactcattggcaacatccttcattctatggatatttt
cccactgcgtgcagctttccaggtatactggccgatctcttggcaagcagcactcctaat
cctgggtttaactggtcatgtagtccggcatgtactgaacttgaagcactcatgatggat
tgggcagccgatctcctgggtttacacaaagaatttttcaactcttcgaataagggtggt
ggagtgattcaaacaaccgcatctgactcggctttagtagccgttgtcgcggctcgttca
cggtaccagcgtcttcatcccgatgtcctattcaaggatttaattatttataccacgact
caaacccattcacttggtctcaaagctggtctcatccttggcataggtgttcgcgctatt
gaagtcgatgctcacgataaatatgcactgcgtggctccacattgaggaagacattagaa
gatgatgcagctgatggaaaacacccgtttatattaattgctacactcggtactacctcg
tcaggcgcatccgataatatgccggaaatcagaaacatcgccaaagattatccttctctt
tggattcatgtcgacgctgcttgggcaggcgtcgttttctcctgtccggaataccgcgat
aaattatatcatacagatatcaacgaaatggccacgtcattttgtaccaacttccacaaa
tggggtctagtaaactttgattgctcggcattttgggtacgcgatcggtctttgttgacg
gaagctttagatattactcctccttttttgagaaccaaggaaggcgattctggacaagtt
gttgactatcgtaattggcatctcgctctcggtcggagattccggtctctcaagatgtgg
tttgtcttccgaacttacggggttgatggtttccagggttatatcagacgttgcatcggc
ttgaatactttattccaggaaaagattaacgaaacgtcatctcttctggaactcgtaaca
acaccttcactctcattgagtgtcattcgcatctcaccagctgcattgtcgccgtcgtcg
tcatcttccgactcgactgacctatcaacacaagatttcatgaataccctcaatcaaacc
ttttattctcgattgtcagcgcgaaacgatatctttctgacacaaacgatccttaatggc
gctttctgtatacgattttctatcggagctgaacttacaaccgaagacgatatctgccgg
gctgttgatactcttatcgaggaagccaagaatgttgttgaggagctcagagttaagaat
gataagacggagcagagtatagcaaatggatccgttagtgccggggtttag

DBGET integrated database retrieval system