KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT132509Help
Entry
AGABI1DRAFT132509 CDS       T03136                                 

Gene name
AGABI1DRAFT_132509
Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00511  Other glycan degradation
abp00513  Various types of N-glycan biosynthesis
abp00520  Amino sugar and nucleotide sugar metabolism
abp00531  Glycosaminoglycan degradation
abp00603  Glycosphingolipid biosynthesis - globo and isoglobo series
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
   00531 Glycosaminoglycan degradation
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
   00604 Glycosphingolipid biosynthesis - ganglio series
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
   00511 Other glycan degradation
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:abp03110]
    AGABI1DRAFT132509 (AGABI1DRAFT_132509)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AGABI1DRAFT132509 (AGABI1DRAFT_132509)
Chaperones and folding catalysts [BR:abp03110]
 Intramolecular chaperones
  Others
   AGABI1DRAFT132509 (AGABI1DRAFT_132509)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 18827692
NCBI-ProteinID: XP_007334196
JGI: Agabi_varbur_1_132509
UniProt: K5VLA4
Position
Unknown
AA seq 604 aa AA seqDB search
MTSGTKPLRLSPKFTIKFSQKVTKDISDAAQRTTKFLKTDRLRALVPDRGASLSGVLHSA
NVLHTLTVNLTPSNGVITSLSEEVMKGIGAQDESYWLEVPADGNTAFLSANTALGVFRGL
TTFEQLWYDLDGVVYTTQAPVQIEDAPAYPYRGFMLDTSRNFFPVEDIKRTLDAMSWVKI
NHFHWHVVDSQSFPLVVPRFEEISSKGAYSSAEVYMPQDVKDIVEYAAARGIDVMVEIDI
PGHTAVISKSYPLHVACPEATPWSHFANEPPAGQLRITSPSTVSFTTDLIRAVSSMFPSK
LFSTGGDEVNMNCYKKDWLTQRDLGAQGKNIEQALDSFTQVTHSVLTKAGKTPVVWEEMV
LEHQPRLSNDTIVLVWISSSHAKKVAKKGHRLIHAASDYFYLDCGGGGWMGNHINGNSWC
DPFKTWQKAYSFNPTEGLQSYQRNLVLGGQQLLWAEQAGPSNLDSIVWPRAAASAEVFWS
GPGGDVNNALPRLHDIAYRFIQRGVKAIPLQPHWCALRPGACNMDPRLKFLMRIRDLVRT
NAGIDLAFDLPWELLGIPKVENLVHLVCPFCIPLLAMGIVTLYGRWNSPPEVAAETDDLD
LFFS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacatctggaaccaagccgcttcgtctttcgcccaaatttacaatcaaattttcccag
aaagtaacaaaagatatctccgacgccgcccagcgtaccactaagttcctcaaaacggac
cggcttcgggctctcgtacccgaccgtggcgcctcattatctggcgtactacactcggcc
aatgttctacatacccttacagtcaaccttactccatcgaatggtgtaatcacgagtctt
tccgaagaagttatgaaaggcatcggggcacaggatgagagttactggttggaagttcca
gctgacggaaatactgcgtttctgagcgcgaacacagccttgggcgtgttccgcggatta
acgactttcgaacaactgtggtacgatttggatggggtggtttatacgactcaggccccc
gttcaaattgaagatgcccctgcctatccgtaccgcggatttatgttggatacttcgcgc
aacttcttcccggtcgaggatatcaagcgcactttggacgcaatgagctgggtcaagata
aaccactttcattggcatgtcgtcgattctcagtcattcccccttgttgttccgagattt
gaagagatatcgtcaaaaggagcgtattcatcagcagaagtatatatgcctcaagatgtt
aaggacatcgttgaatatgctgctgcacgtgggattgacgttatggtcgaaattgatatt
cctggacatacggctgtcatttcaaaatcataccccctgcatgtagcgtgtcctgaagcc
actccatggtcccattttgcaaatgaaccacctgcgggccaacttcgcatcacaagtcca
tccacagtttcgtttaccactgacttgattcgagctgtttcctcaatgtttccatcaaaa
ctgtttagtacgggtggggacgaagttaatatgaattgctacaaaaaggattggttaact
caacgggatcttggggcgcaagggaagaatatcgaacaagctttggattctttcacacaa
gtcacacattcggtccttacaaaagcgggaaagacgccggtagtatgggaagaaatggta
ctcgaacatcaacctagacttagtaatgataccattgtattggtctggatatcatctagc
catgcgaaaaaggtcgcgaaaaaaggtcacagacttattcacgctgcctccgattatttt
tatcttgattgcggaggtggaggttggatgggaaatcatataaacgggaatagttggtgt
gatcctttcaaaacatggcaaaaggcgtattcctttaatccgactgaaggattgcagagt
tatcaaaggaatctagtactcggtggacaacaattgttatgggctgaacaggctggtcct
tcgaaccttgactctattgtttggccgcgcgctgccgcttcagcagaagtattttggtcc
ggtcctgggggagatgtgaataacgccttgccgaggttgcacgatatcgcgtatcgattt
attcaaaggggtgtgaaagctattccattgcaaccgcattggtgtgctctgcgacccggg
gcatgtaacatggacccgcggttgaaattcttgatgcgaatcagggatttggtgagaaca
aatgcggggattgatttggcctttgatttaccctgggagcttctggggattcccaaggtg
gagaatttagtgcatttagtttgtccgttctgtattccacttcttgctatgggtattgtt
acattatatggacgctggaattcgcctcctgaagtagcagccgaaaccgatgatctcgac
ttatttttttcgtga

DBGET integrated database retrieval system