KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT55787Help
Entry
AGABI1DRAFT55787  CDS       T03136                                 

Gene name
AGABI1DRAFT_55787
Definition
(RefSeq) hypothetical protein
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
abp01230  Biosynthesis of amino acids
Module
abp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AGABI1DRAFT55787 (AGABI1DRAFT_55787)
Enzymes [BR:abp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AGABI1DRAFT55787 (AGABI1DRAFT_55787)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AGABI1DRAFT55787 (AGABI1DRAFT_55787)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     AGABI1DRAFT55787 (AGABI1DRAFT_55787)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS PRAI GATase Peptidase_C26 QRPTase_C
Motif
Other DBs
NCBI-GeneID: 18830142
NCBI-ProteinID: XP_007328063
JGI: Agabi_varbur_1_55787
UniProt: K5XBR4
Position
Unknown
AA seq 801 aa AA seqDB search
MSGMPGTSSLPPYLAGQLDVLMIDNFDSFTWNLYQQLCLLGASVTVIRNDAISPDLFPQL
KINSLIISPGPGHPHTDSGVSKDAIRYFTGKVPILGVCMGLECLVDVYGGSIQYAGEIMH
GKVSRIRHDNRGCYRDAPQGLKSIRYHSLSASYETLPAELAITSVTEESGVIMGVRHRKY
TVEAIQYHPESILSEGGDNLVKNFLSLRGGLWEQNPGAHVLDATMPPFLPEIPDDVSTPV
TTQKKVPSILDKIYKQRLLDVDQAQATPGSTIQDLQTLYSLNISPPQIDFTVRIRQGTSP
DFPAMFAEIKRASPSKGPIALNINPAAQALKYALAGAHTISVLTEPKWFLGSLHDMLHAR
QAVAHLPNRPAILRKDFILSRYQVLESRIWGADSILLIASMLSESSLRDLYSYALELGME
PLVEVNNAQEMELALSLPAKVIGVNNRNLHDFKVDMNTTSRLSDMTKGKNVVLCALSGIA
SRNDVERYKGQGVGAILVGESLMKAKDVGEYIKELMGTPSVEAKKEEQGTPLVKICGVKT
KDQALAIADAGADLLGLMFAKSKRRIDRQVAKEIAAAIRDRRFNFDFKPISTSSANEPWF
SMNAKRLANITQQTRPLLVGIFQNQPLEEILETVADVQLDIVQLHGNEPVEWATQIPVPV
IRAFHLGFKDGRIRGVENITHPGKNRFILFDSVRGDGLSGGSGKIVDWAFAKKVADGGEI
LLNGPRAYLGSEDTSSTTNSLDGSRLPIILAGGLTPENVAEAVKQVRPWAVDVSGGVETE
DGDLKDLEKVRLFIARVKLLD
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaatgccgggaacttcatctcttcctccctatcttgctggacagcttgacgtc
ctcatgatcgacaattttgactcattcacctggaatctctaccaacagctttgtctcctt
ggtgccagtgtcaccgtcatccgcaacgatgcgatatccccagacttatttcctcaactc
aaaatcaattccctcatcatctctccaggtccaggtcacccccacacagattctggagta
tcaaaggatgccattcgctatttcactggcaaagttcctatcctcggtgtttgtatggga
ttggaatgccttgtcgatgtctatggcggctcaatccagtacgccggtgaaatcatgcat
ggcaaagtcagtcgaatacgacacgacaaccgtggatgctacagagacgctcctcaaggc
ctgaagtcaattcgttaccactcgcttagcgcttcctacgagactcttcccgcagagctc
gctattacctccgtgaccgaagaatctggcgtgataatgggtgttcgccatcgcaaatac
actgtcgaagctattcagtatcacccagaaagtatactcagcgagggcggtgacaacctt
gttaagaattttctttccttgcgaggcggactctgggagcaaaaccccggggcccacgtc
cttgatgcgactatgccacccttcctacctgaaatcccagacgatgtctctacacctgtg
actacccagaaaaaagtaccttcgatcttggataaaatctacaaacagcgactcctcgat
gtcgatcaagcgcaggcaacgccagggtctacaattcaggatcttcagactctctactcc
ttgaatatctccccacctcagatcgacttcactgtacgcatcaggcaaggcacctctcct
gatttccccgccatgttcgctgagataaagcgcgcatcgccctcgaaaggccctattgca
ttaaatatcaatcctgccgcacaggctctcaaatatgctctggctggagcccacacaatc
tctgtcttgactgaacctaaatggttccttggatcacttcatgacatgctgcatgcccgt
caagcagttgcccatctccccaatagacctgctatccttcgcaaagactttattctcagc
aggtaccaagtacttgaatcgaggatttggggtgcagatagtattcttctcattgccagt
atgctctcggagtctagtctccgcgatctttacagttacgcactagagttgggcatggaa
cctcttgttgaagtcaataatgcgcaggaaatggagctcgccctgtccttacctgccaaa
gttatcggcgtcaataatcgcaatctccatgactttaaggttgacatgaacacgaccagt
agactgagtgatatgacgaagggaaagaatgtcgttctttgtgcgcttagtggtattgcg
tcgagaaatgatgttgaacggtacaaaggtcaaggcgtcggcgcgatactcgtgggcgag
agcttgatgaaagcaaaagatgtaggtgaatacatcaaggagctaatggggacgccttcg
gttgaggccaagaaagaagaacaagggacacctcttgtgaagatctgtggcgttaaaact
aaggatcaggcactagctatcgcggatgctggtgctgatcttctcggactgatgttcgcc
aaatcaaagcgtcgcatcgatcgccaggttgcaaaggaaattgctgcagccatcagggat
cgccgattcaactttgatttcaagccgatttcaacttcatctgcaaacgaaccctggttc
tccatgaatgccaaacgccttgcgaatattacgcaacaaacgcgcccactcctcgttggt
atattccagaatcaacctttggaagaaattctcgaaacggtagcggatgtgcagctggat
attgtccagttacacgggaatgagccagtggaatgggcaactcagatcccagtccctgtc
atacgtgcgttccacctcggattcaaagatggcaggattcggggagtagaaaacatcact
catcctggcaaaaatcgtttcatccttttcgatagcgtccgaggcgatggattgagtgga
ggtagcggcaagattgtggactgggcgttcgcaaagaaggtcgctgatggtggtgaaatt
ctactcaatggcccaagggcatatctgggatccgaagacacgtcgtcgaccacgaattca
ttggatggcagtcggttgcctatcattcttgccggtggtttgacacccgaaaatgtcgcc
gaggctgtgaagcaagtcaggccttgggctgttgatgtaagcggcggtgtcgagaccgag
gatggtgatctgaaggacctagagaaggtcaggctgttcattgcccgcgttaagctgcta
gactag

DBGET integrated database retrieval system