KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT65982Help
Entry
AGABI1DRAFT65982  CDS       T03136                                 

Gene name
AGABI1DRAFT_65982
Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00260  Glycine, serine and threonine metabolism
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01130  Biosynthesis of antibiotics
abp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGABI1DRAFT65982 (AGABI1DRAFT_65982)
Enzymes [BR:abp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AGABI1DRAFT65982 (AGABI1DRAFT_65982)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 18830555
NCBI-ProteinID: XP_007325102
JGI: Agabi_varbur_1_65982
UniProt: K5W972
Position
Unknown
AA seq 404 aa AA seqDB search
MSTQVSPAIQDIIDQVKVDPIPKNYAADNAAKRKEITRTFISDTMTVPSEEMLTYATKAT
LGDDVYFEPTTFALENHIAQLFGKEAALFVGSGTQGNQIAIRTHLKQPPYSLICDKRAHI
YKYEAGGPAFNSGAHVVPIVPANQHHITLEEVEENIVLGNDVHMAPTELVSLENTLNGTI
FPQDEIIRICDYAHSKGIKTHLDGARIWHVAIETGKSLKELCEPFDSVSVCFSKGLGAPV
GSCVIGTKEFVARGRWYRKMWGGGMRQTGFLAAAAAFALSHNFPQLVKAHALANKLEAGL
EELGAVILSRAETCMIFYDPAPLGLDFEEIGQRAEALPEPLILGGSRLVVHIQTAEQAID
DFLSLIRQLAEEKRAAGWVPPTANGHAASALKDVYVRRKVQMTK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcaagtatctcctgctatccaggacatcatagaccaggttaaggtcgacccc
atacccaagaattacgctgcagacaacgctgccaagcgtaaggaaatcacacgaactttt
atatcggacaccatgaccgttccctcagaagagatgcttacttatgcgacaaaagcgaca
ttaggggacgatgtctactttgaaccgacaacttttgctcttgaaaaccacattgcccag
ctctttggaaaggaagccgccttgttcgtggggtcaggaacccaaggaaatcaaattgcc
ataaggacacaccttaaacaacctccttattccctcatttgcgataaaagggcacatatt
tacaagtatgaagctggtggtccggccttcaacagtggcgcacatgtcgtcccaattgta
ccagcaaatcaacatcatattactctagaagaggtagaagaaaacatcgttcttggaaac
gacgtccacatggcaccaactgaactcgtgtcgctcgaaaacactctgaatggaacgatc
ttccctcaggatgagattatcaggatttgtgattacgcacattccaagggtataaagaca
catttggacggtgctcgaatttggcatgttgctattgagaccggtaaaagcctcaaggaa
ctctgtgaaccatttgattccgtcagtgtctgcttcagtaaaggtttaggtgcaccagtg
ggatcctgtgttatcggcacaaaggaatttgtcgcaagagggcgttggtaccgaaagatg
tggggtgggggtatgaggcagacgggtttccttgccgctgctgcagctttcgctctctcg
cacaatttcccgcagctcgttaaggctcacgcgcttgcaaataaactcgaggctggcctt
gaggagctcggtgctgttattctgagccgggcagagacttgtatgatcttttacgatcct
gcgcctctgggactcgactttgaggagattggccagcgcgctgaagctctgcctgaacca
ttaatactaggtggttcacgtctggtggtccacattcaaaccgctgagcaggcaatcgat
gatttcctgtcattaatccgtcagctcgctgaagagaaaagagctgcgggttgggttcct
ccaactgctaacggtcatgctgcttcagcgctcaaggatgtctatgtgcgtcgaaaggta
caaatgacgaagtag

DBGET integrated database retrieval system