KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT79987Help
Entry
AGABI1DRAFT79987  CDS       T03136                                 

Gene name
AGABI1DRAFT_79987
Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00071  Fatty acid degradation
abp00410  beta-Alanine metabolism
abp00592  alpha-Linolenic acid metabolism
abp00640  Propanoate metabolism
abp01040  Biosynthesis of unsaturated fatty acids
abp01100  Metabolic pathways
abp01110  Biosynthesis of secondary metabolites
abp01200  Carbon metabolism
abp01212  Fatty acid metabolism
abp04146  Peroxisome
Module
abp_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
   00592 alpha-Linolenic acid metabolism
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
   01040 Biosynthesis of unsaturated fatty acids
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGABI1DRAFT79987 (AGABI1DRAFT_79987)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AGABI1DRAFT79987 (AGABI1DRAFT_79987)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 18831629
NCBI-ProteinID: XP_007333970
JGI: Agabi_varbur_1_79987
UniProt: K5WJB4
Position
Unknown
AA seq 677 aa AA seqDB search
MSATHDASTQNGIDMANARRTTSVDISSICHLLHNGRTQWETRERIVAILSSDPVFDKSQ
RHYQSRAERYTRAVAMMNRIYELQVIHNWSQHEVGVALFNIDESLPISLHNIAFQPPVMS
QGSPELILEYGPLVANRGIMGCYMQTELGHGSNVSCLETTATYIPETKEFEIHSPTLSST
KWWIGSLAKTSTHGVVQAKLILGGVDHGPHLFFVQLRSLENHKNMPGIVIGGIGPKALGG
FAANDHGFARFDHVRIPKIQMLSKFAQVTDDGKYVQPPHAKLSYGGMLYIRSTMVGSNGW
AMAKAATVAIRYATVRRQGEKGPDGLERQIITYPSVHIRLLPILSHAYVYIQLGKVLTRL
FDAMSSRLQQKDTSLLPEMHAITSGLKITVTTTCIQDIETARRSMGGHGFSAFSGLGSLY
ADQLPTVTFEGDNFVLNKQVIRAAQKSYTNILKSKDVFNLSSSNAYLRLLVGEHSMPSLP
SDSEWQNPATAVLLLEWRAALLVRELAQHVDDLDASATQRTAGAVTEAFIAARVMEMIKE
LPVVIGDKQRNVKILEKLYLMYLLTTLETGVVDLLSFGVFGVAKGKGDVTRSLRLTIKNL
CLELLPEAIGLTDAFGYTDWELDSALGIYDGKVYEQLWRRAHSEPINDAEMSAVYEESIK
PILRRGQQQAADMRAKL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacccatgatgcaagcacgcaaaatggcatcgacatggccaatgcacgacgc
acgacttcggtagatatctcctcgatatgtcaccttcttcacaacggacgtacgcaatgg
gagactcgcgagaggattgttgccatactgagcagtgatcctgtatttgacaagagtcaa
cggcattaccagagcagagcagagcgttatacgagagctgtcgccatgatgaaccgcata
tacgagctccaagttattcataactggtcccagcatgaagtcggagtcgccctcttcaac
attgatgaatcacttcccatttcgctgcacaatatagcattccaaccgcctgtcatgtcg
caaggatctcccgaactaatcttggaatacggaccgcttgtcgccaatcgcggaattatg
gggtgctacatgcagacagaactaggccacggctcgaacgtttcttgccttgaaactacc
gctacttatattccagagactaaggagttcgagatccactccccgaccttgtcgagtacc
aaatggtggattggctcacttgcaaagacctcaactcatggtgtcgttcaagccaagcta
attctcggtggtgtagatcatggaccacatttgttctttgtccagttgaggtccttagaa
aatcacaaaaacatgcctggtatcgtgatcggcggtattgggcctaaggctctcggaggt
ttcgctgcgaatgatcatggctttgctcgctttgaccatgtccgtatccctaaaattcag
atgctttctaaatttgctcaggtcacggatgacggcaagtacgtccagccaccgcacgct
aaattgagctatggcggaatgttgtacattcgttcaaccatggtaggatcaaatggatgg
gcaatggccaaagccgccaccgtagctattcgctacgctactgttcgtcgtcaaggagag
aaaggcccggatggtttagaacgtcaaatcataacttatccttctgttcatatccgactc
ttgccaattctctcacatgcctacgtctatattcagctcggaaaggtcttgacgagattg
tttgacgccatgtccagccgtctacagcagaaagatacatcccttctccccgagatgcat
gctatcacaagtggccttaaaatcaccgtaaccactacctgtatacaagatattgaaact
gctcgacgttccatgggtggccatggttttagtgcattttcaggcctagggtcattatac
gcggatcaacttcctactgtaacttttgagggtgacaactttgttctgaacaaacaagtc
atccgtgcagcacaaaaatcgtatacaaatatcctcaaatcaaaggatgtattcaacctc
tcatcatccaacgcttatctccgacttcttgttggcgagcattctatgccctcgcttcct
tcggatagcgaatggcaaaatcctgccacagctgtattactccttgaatggcgagcagct
cttcttgttcgggagttagcacaacatgtcgatgacctcgatgcatctgcaacacaaaga
acagctggagcagtcacagaggcatttatagctgcgagagtcatggagatgattaaagaa
ttaccggtggttattggggacaagcagagaaacgtgaagatactggaaaaattgtatcta
atgtatctcttgacaacacttgaaactggcgttgtcgatttgttgtcctttggtgtattt
ggcgtcgcgaaagggaaaggcgacgttacccgctctttgagactgactatcaagaactta
tgcctggaactattacccgaagctattggtctgaccgacgcttttggatacacggattgg
gaattggatagtgcccttggtatttatgatggaaaggtttacgaacagctctggcgtcgc
gcccattcggaaccaataaacgatgctgagatgtccgctgtctatgaggaatctataaaa
ccgatcttacggcgtggccagcagcaagccgctgatatgagagcgaaactttag

DBGET integrated database retrieval system