KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT80424Help
Entry
AGABI1DRAFT80424  CDS       T03136                                 

Gene name
AGABI1DRAFT_80424
Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
abp00450  Selenocompound metabolism
abp00970  Aminoacyl-tRNA biosynthesis
abp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abp01007]
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abp03016]
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
Enzymes [BR:abp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AGABI1DRAFT80424 (AGABI1DRAFT_80424)
Amino acid related enzymes [BR:abp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AGABI1DRAFT80424 (AGABI1DRAFT_80424)
Transfer RNA biogenesis [BR:abp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
 Prokaryotic type
   Other AARSs
    AGABI1DRAFT80424 (AGABI1DRAFT_80424)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e DUF4315
Motif
Other DBs
NCBI-GeneID: 18831666
NCBI-ProteinID: XP_007334378
JGI: Agabi_varbur_1_80424
UniProt: K5WW27
Position
Unknown
AA seq 581 aa AA seqDB search
MWAARRASQRCGSVFVRRLNVLSASNTKPFYVTTPIFYPNAEPHIGHLQTLLIGDIYARY
NRLARPWNPVHFLAGTDEHGLKIQQAAAAAGKEPGAFCEELSKRFQELAEAASIQSTSFV
RTSSPKHRKVVEHVWNELTAKGLIRKTTYSGWYSVTDECFYTKKQVVHAPTPENPEARHA
IATNSAVEWHEEENYVFRLREFSEKLLEHYNEHPNSIYPAQYHLDVVQYLKAVIDGAQGE
GLDELSISRSIDRLSWGIPVPGDPSQTIYVWFDALLVYLSGVGYPDFEGAPKDLLPWPPN
MQIIGKDILRFHAIYLPSILLALDLPLPHHILAHAHWTVDQKKMSKSVGNVADPMKTIAD
YGVDKVRWYLARAGRSRTDVDWSQNELEKYSNEIQSLLGNYVLRVTSKKLFKSLDGTQEM
SIKQIYQHYKKQDDSKSKSLVDLIDTQRTTPARVKHGIENLEIAEAVRALVLLLREGNKT
LTELAPWKKNTPPELLYANYVTGLETLRIAGICLQPFIPSTAEKLLDMLGLERERGRTWR
AVERVGGTDACERVKKDIMDIHGVPLFQSKKPLPATVAKPV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctgctcgacgtgcttcccagcgctgcggttcagtctttgtgcgccgtctcaac
gtgttaagcgcgtcaaacacgaaacccttctatgttaccacacccatcttctacccaaat
gctgaaccacacatcggacatttacaaaccctgctcattggcgacatatatgctcgttat
aatcgcttagcccgtccctggaacccggtccacttcctcgctggtacagacgaacatggg
cttaaaatacaacaggctgctgctgctgctggaaaggagcccggtgctttttgtgaagaa
ctaagcaaacggttccaagaactagcagaagccgcaagcattcaatcaacttcgttcgtt
cgtacatcctcacccaaacatcgcaaagtcgtggaacatgtctggaatgagctcacggcg
aaagggcttatccgcaaaacaacctattcgggttggtattccgttaccgacgaatgtttt
tatacaaagaagcaagtcgtccatgcacccactccggaaaacccagaagcccgccatgct
attgccaccaattctgccgtcgaatggcacgaagaagagaattatgttttccgtctgaga
gaatttagtgagaagctgctggaacattacaacgaacatccaaactcgatatatcctgcg
caataccaccttgacgtcgtacagtacctgaaagcagtcattgatggtgcacaaggagag
ggtctggacgagcttagcatctccaggtcgattgatcgattgagttggggcattccggtc
ccgggagacccttcacaaaccatttatgtctggtttgacgcacttttggtctatctctcc
ggggtaggataccctgattttgaaggagctccgaaagacctgctgccctggccacctaac
atgcagatcatcggaaaggatattctacgatttcatgctatctatttgccatccatatta
cttgcacttgatcttccccttccccatcatattcttgcgcatgcgcactggacagttgac
cagaagaagatgtccaaaagcgtcggaaatgtggcggatccgatgaaaaccattgccgac
tacggagtcgataaagtgaggtggtatcttgctcgtgcgggtcgttcgcgtacggatgtt
gattggtcgcaaaacgagcttgagaaatacagcaacgagatccagtcattgcttggcaat
tatgttctccgtgtaacgtctaaaaaacttttcaaatcccttgatggaactcaggaaatg
tcaatcaagcaaatttatcagcattacaagaagcaagatgattctaaaagcaaatcgttg
gtcgatcttatagacacacagcgcactactccagccagggtgaagcacgggatagaaaat
ttggagattgctgaagcagtgcgagctttggttttactattgcgtgaagggaataaaacc
ctcacagaactcgcaccttggaagaaaaatactccaccagagttgctctacgcaaactat
gtcactggtcttgagactttacgtatagcgggtatctgtctccagccctttataccaagc
acagcagagaagctattggatatgctgggattggaaagggaaagaggaagaacgtggaga
gctgtagaaagggttggtggaacagatgcatgtgagagggtcaagaaggatatcatggat
atccatggtgtacctctgttccaatctaagaaaccgcttcctgccactgtcgctaagcca
gtttga

DBGET integrated database retrieval system