KEGG   Azospirillum brasilense Az39: ABAZ39_01350Help
Entry
ABAZ39_01350      CDS       T03288                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00620  Pyruvate metabolism
abq00630  Glyoxylate and dicarboxylate metabolism
abq01100  Metabolic pathways
abq01110  Biosynthesis of secondary metabolites
abq01120  Microbial metabolism in diverse environments
abq01200  Carbon metabolism
Module
abq_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAZ39_01350
   00630 Glyoxylate and dicarboxylate metabolism
    ABAZ39_01350
Enzymes [BR:abq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABAZ39_01350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AIB10683
UniProt: A0A060DI67
Position
283176..284780
Genome map
AA seq 534 aa AA seqDB search
MATTISGLEILGPITPGVETILTPEALAFLAELEGRFGAERLRLLDVRTKRRALIDQGHR
LDFLPETRAIREADWTIAPLPHDLLDRRVEITGPVDRKMVINALNSGAKVFMADFEDSNC
PSWANLIDGQINLRDAVRRTIAFDDPASGKKYRLNDKTAVLKVRPRGWHLAEKHVRFDGE
PVSGALFDFALYAFHNARELLAHGSGPYFYLPKLESHFEARLWNEVFSVAEDYLKIPHGS
IKATVLVETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKTFRNDPAAVLPDRAEVT
MATPFLQSYSLLAVKTCHRRGAPAIGGMAAYIPVKDDPAANEVAFSKVRADKEREVSNGH
DGTWVAHPGLVPVAREVFDAYMRKPNQIDRKRADVSVTAADLLAVPEGPKTERGLRNNVA
VAIGYLEAWLRGIGCVPLFNLMEDAATAEISRTQLWQWVHHGAALDDGRPVTMELVDETI
AEELAAWKTRVGDRAFERGLYEDAAVMLRDLVERDDFVDFLTLPAYDRIVAQGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaccatctccgggcttgagatcctgggtccgatcacgccgggcgtcgagacg
atcctgacgccggaggcgctggccttcctggcggagctggaagggcggttcggggcggag
cggttgcgcctgctcgacgtgcggaccaagcggcgggcgctgatcgaccagggccacagg
ctagactttctgccggaaacccgcgccatccgcgaggccgactggaccatcgcgccgctg
ccgcacgatctgctcgatcgccgggtggagatcaccgggccggtggaccgcaagatggtc
atcaacgcgctgaattccggcgcgaaggtcttcatggcggatttcgaggattcgaactgc
ccgtcctgggccaacctgatcgacgggcagatcaatctgcgcgacgccgtgcgccggacc
atcgccttcgacgatcccgcgtcggggaagaagtaccggctgaacgacaagaccgccgtc
ctcaaggtccgcccgcgcggctggcatctggcggagaagcacgtccgattcgacggcgaa
ccggtgtccggcgcgctgttcgacttcgccctctacgccttccacaacgcgcgggagctg
ctggcccacggctccggcccctacttctacctgccgaagctggaaagccatttcgaggcg
cggctgtggaacgaggtgttttcggtcgccgaggattatctcaagatcccgcacggctcg
atcaaggcgaccgtgttggtcgagaccatcctggccgccttcgagatggacgagatcctc
tacgagttgcgcgaccattccgccgggctgaactgcggacgctgggactacatcttcagc
ttcatcaagaccttccgcaacgaccccgccgccgtcctgcccgaccgggcggaggtgacg
atggcgacgcccttcctgcagtcctacagcctgctggcggtcaagacctgccaccgccgc
ggcgccccggccatcggcggcatggccgcctacatcccggtgaaggacgatcccgcggcc
aacgaggtcgccttctccaaggtccgcgccgacaaggagcgcgaggtgtccaacggccat
gacggcacctgggtggcgcatcccggcctcgttcccgtcgcgcgggaggtcttcgacgcc
tacatgcgcaagcccaaccagatcgaccgcaagcgcgccgacgtcagcgtgaccgccgcc
gacctgctggccgtcccggaggggccgaagacggagcgcggcctgcgcaacaacgtggcc
gtcgccatcggctatctggaggcgtggctgcgcggcatcggttgcgtgccgctgttcaac
ctgatggaggacgccgccaccgccgagatcagccgcacccagctctggcagtgggtccac
cacggcgccgcgctggacgacggacgcccggtgaccatggaactggtggacgagaccatc
gccgaggagctggccgcctggaagacccgcgtcggcgaccgcgccttcgagcgggggctg
tacgaggacgccgcggtgatgctgcgcgacctcgtggagcgcgacgacttcgtggatttc
ctgaccctgccggcctacgaccgcatcgtcgcgcagggggcgtga

DBGET integrated database retrieval system