KEGG   Azospirillum brasilense Az39: ABAZ39_03280Help
Entry
ABAZ39_03280      CDS       T03288                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00361  Chlorocyclohexane and chlorobenzene degradation
abq00625  Chloroalkane and chloroalkene degradation
abq01100  Metabolic pathways
abq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABAZ39_03280
   00361 Chlorocyclohexane and chlorobenzene degradation
    ABAZ39_03280
Enzymes [BR:abq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     ABAZ39_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AIB11056
UniProt: A0A060DAD3
Position
685204..685815
Genome map
AA seq 203 aa AA seqDB search
MTKPTTVVFDIGQVLIEWDPRHLYRELFDGYEDLMEDFLDTVCTPAWNLEQDRGRPWDEA
VALLTAEFPDCRELIRAYHERWEEMVPGPMAGTPEILMELKQRGTPLYSITNFSSEKLAL
TRRRFDFLNVFDGIIVSGDERLVKPDPAIFQLLLDRYGLSAADCYFIDDSPANVEAARAL
GMTVHRFSGAASLRAELEELGLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccgaccaccgtcgtcttcgacatcgggcaggtgctcatcgaatgggacccg
cggcatctctaccgcgagctgttcgacgggtacgaggacctgatggaggacttcctcgac
accgtctgcacccccgcctggaacctggagcaggaccgcggccggccctgggacgaggcg
gtcgcccttctgaccgccgagtttcccgactgccgcgagctgatccgtgcctatcacgag
cggtgggaggagatggtgcccggccccatggccgggacgccggaaatcctgatggagctg
aagcagcgcgggacgccgctctactccatcaccaacttctcgtcggaaaagctggcgctg
acccgcaggcgcttcgatttcctgaacgtcttcgacgggatcatcgtgtccggcgacgag
aggctggtgaagccggacccggcgatcttccagcttcttctggatcgctatggcttgtcg
gcggcggactgttacttcatcgacgacagccccgccaacgtcgaggccgcccgcgccctc
ggcatgacggtgcatcgtttctccggcgccgccagcctgcgcgccgaactggaggagctg
gggcttctgtag

DBGET integrated database retrieval system