KEGG   Azospirillum brasilense Az39: ABAZ39_13170Help
Entry
ABAZ39_13170      CDS       T03288                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
abq  Azospirillum brasilense Az39
Brite
KEGG Orthology (KO) [BR:abq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ABAZ39_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIB12920
UniProt: A0A060DJI7
Position
2767413..2767805
Genome map
AA seq 130 aa AA seqDB search
MYTKVTRAIRVTVQPVFLDEQSMPAESRYVWAYHVRIENEGQETVRLRTRYWHITDALGR
VQEVRGPGVVGEQPVLEPGGSFEYTSGTPLPTPSGIMVGSYRFETGGGEAFDVAVPAFSL
DSPHQPRQLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgaaagtcacccgcgcgatccgcgtcaccgtccagccggtctttctcgacgag
cagtccatgcccgccgaaagccgctatgtctgggcctatcacgtccggatcgagaacgaa
ggccaggagaccgtccggctgcgcacacgctattggcacatcaccgacgcgctggggcgc
gtgcaggaggtccgcgggccgggcgtggtgggcgaacagccggtgctggaacccggcggc
agcttcgaatacaccagcgggacaccgcttcccacgccatccgggatcatggtcggctcc
taccgcttcgaaacgggcggcggcgaggccttcgacgtggcggtccccgccttctcgttg
gacagcccgcatcagccccgccagctgaactga

DBGET integrated database retrieval system