KEGG   Azospirillum brasilense Az39: ABAZ39_14460Help
Entry
ABAZ39_14460      CDS       T03288                                 

Definition
(GenBank) pseudouridine synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
abq  Azospirillum brasilense Az39
Brite
KEGG Orthology (KO) [BR:abq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abq03016]
    ABAZ39_14460
Enzymes [BR:abq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     ABAZ39_14460
Transfer RNA biogenesis [BR:abq03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    ABAZ39_14460
 Prokaryotic type
    ABAZ39_14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Motif
Other DBs
NCBI-ProteinID: AIB13164
UniProt: A0A060DQC7
Position
3035689..3036627
Genome map
AA seq 312 aa AA seqDB search
MARKRKGEPIHGWVVLDKPAGMTSTQALSKVRRHLNAEKAGHGGTLDPIATGILPIALGE
ATKTVSYAMDGEKTYRFTVAWGTRTTTDDREGTAVETSAVRPDAEAIRAALPGFLGFVEQ
IPPQYCALKINGERAYDMAREGEVVDIAPRTVRIDRLELIEIPDADHAVLEVDCGKGTYV
RSIARDLAERLGTVGHIRDLRRLRVGSFTLDGAISLDDLTAMEQGAAVERLLLPIETALD
DIPALALTDAEAHRLKHGQTVALLTRQDRERLTALRGDVGGDGTVIALFGGKPVALARVE
GAEVRPVRVLNL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgtaagcgcaagggtgagccgatccacggctgggtcgtgctggacaagccggcg
gggatgacctcgacgcaggcgctgtccaaggtgcggcgccatctgaacgcggagaaggcc
gggcacggcggcacgctggatcccatcgccacgggcatcctgcccatcgcgctgggcgag
gcgaccaagaccgtctcctacgccatggacggcgagaagacctaccgcttcaccgtggcc
tggggcacccgcaccaccaccgacgaccgcgagggcacggcggtggagacctccgcggtg
cgtcccgacgccgaggcgatccgcgccgctctgcccggctttctgggtttcgtcgagcag
atcccgccgcaatactgcgctctgaagatcaacggcgagcgcgcctacgacatggcgcgc
gagggcgaggtggtggacatcgccccgcgcaccgtgcgcatcgaccggctggagctgatc
gagattccggacgccgaccacgcggtgctggaggtggattgcggcaagggcacctatgtc
cgttccatcgcccgcgacctcgccgaacggttggggacggtggggcacatccgcgatttg
cgacgtctgcgcgtcgggtccttcacgctggacggggcgatttccctggacgatctgacc
gcgatggagcaaggtgccgcggtcgaaagacttctgcttccgatcgagaccgcgctggac
gacatcccggcgctggccctgacggacgcggaagcgcaccgactgaagcacggccagacg
gtggcactcctcacccggcaggaccgcgaacgcctcacggcgctgcgcggcgatgttggt
ggggatggcaccgtcattgcgcttttcggcggcaagccggtggcgctggcgcgtgtggag
ggggcggaggtccgtccggtgcgcgttctcaacctatga

DBGET integrated database retrieval system