KEGG   Azospirillum brasilense Az39: ABAZ39_16250Help
Entry
ABAZ39_16250      CDS       T03288                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00640  Propanoate metabolism
abq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAZ39_16250
Enzymes [BR:abq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     ABAZ39_16250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AIB13493
UniProt: A0A060DQR5
Position
AbAZ39_p1:371740..374376
Genome map
AA seq 878 aa AA seqDB search
MNTAHRKPLPGTPLDHFDARAAVNALRPGAWDGLPYVSRVLAEQLVRRCDPALLDDALQQ
LVERRRDRDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAKINPVVPTQLIVDH
SLAVEYGGDDPQAFEKNRAVEDRRNEDRFHFIDWTRRAFENVDVIPAGNGIMHQINLETM
SPVIQVRDGVAFPDTCVGTDSHTPHVDALGVIGIGVGGLEAETVMLGRASMMRLPDIVGV
RLTGARQPGITATDIVLALTAFLREQRVVGAWIEFFGEGAAGLSVGDRATISNMCPEYGA
TAALFHIDQQTIDYLRLTGRAPEQVALVETYAKTLGLWADALRTAEYERVLAFDLASVER
TMAGPSNPHRRLPTAALKERGIAVGLDTAQEEERAGLLPDGAVVIAAITSCTNTSNPRNV
VAAGLLAKKANALGLVRKPWVKTSFAPGSKVARLYLEEAGLLAELETLGFGIVAYACTTC
NGMSGALDPAIQREIVDRDLYATAVLSGNRNFDGRIHPHAKQAFLASPPLVVAYAIAGTV
RFDIERDALGVDRDGKPITLKDLWPSDAEIDAIVASCVRPEQFRAVYDPMFAANRDGVEK
TSPLYDWRPASTYIRRPPYWDTEGVGALAATPRTLTGMRPLAVLPDNITTDHLSPSNAIL
ANSAAGEYLARMGLPEEDFNSYATHRGDHLTALRATFANPQLVNEMAVVEGAVRKGSLTR
LEPDGTVMRMWEAIETYLERRQPLIVVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFER
IHRTNLIGMGVLPLEFKPGTTRLTLGLDGSETYDVTGERRPRTDLTLVVHRRDGETLRVP
VTCRLDTAEEVSIHEAGGVLQRFAQDFLASESAQKGAA
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgcccaccgcaagccgctgccgggaacgccgctcgaccacttcgacgcccgt
gccgccgtgaacgccctccgtccgggggcctgggacgggttgccctacgtgtcgcgcgtc
ctggccgagcaactggtgcgccgctgcgacccggcgctgctcgacgacgccctgcagcag
ctcgtcgaacgccggcgcgaccgcgatttcccctggtacccggcccgcgtcgtctgccac
gacatcctcggccagaccgccctggtcgatctggccggcctgcgcgacgccattgccgag
cagggcggcgacccggccaagatcaacccggtggtgccgacgcagctcatcgtcgatcat
tcgctggccgtcgagtatggcggcgatgacccgcaggcgttcgagaagaaccgtgccgtc
gaagaccgccgcaacgaggaccgtttccatttcatcgactggaccagacgcgccttcgag
aacgtcgatgtgatcccggccggcaacggcatcatgcaccagatcaaccttgagacgatg
tcgccggtgatccaggtccgtgacggggtggcctttcccgacacctgcgtcggcaccgac
agccacaccccgcacgtcgacgccctgggcgtcatcggcatcggcgtcggcgggctcgag
gccgaaacggtgatgctcggccgcgcctcgatgatgcggctgccggacatcgtcggcgtc
cgcctgaccggcgcgcgccagcccggcatcaccgcgaccgacatcgtgctggccctcacc
gcgttcctgcgtgaacagcgcgtggtcggcgcctggatcgagttcttcggcgagggcgcc
gccggcctgtccgtcggggaccgggcgacgatctccaacatgtgcccggaatacggggcc
accgcggcgctgttccacatcgaccagcagaccatcgactatctgaggctgaccggccgc
gcgccggagcaggtggctttggtcgagacctacgccaagacccttggcctctgggccgac
gcgctgcggaccgccgagtacgagcgcgtgctggcgttcgatctggccagcgtcgaacgg
accatggccggcccgtccaacccgcaccggcgtctgccgaccgcggcgctgaaggagcgc
ggcatcgccgtcggtctcgacacggcgcaggaggaggagcgcgccggcctgctgccggat
ggtgcagtggtcatcgcggccatcaccagctgcaccaacacgtcaaacccgcgcaacgtg
gtggcggccggcctcctggcgaagaaggccaacgcgctggggctggtccgcaagccttgg
gtcaagacctccttcgcgccggggtccaaggtcgcccggctgtacctggaggaggccggc
ctgctggccgagctggagacgctcggcttcggcatcgtcgcctacgcctgcaccacctgc
aacggcatgtccggcgcgctcgacccggcgatccagcgggagatcgtcgaccgcgatctg
tacgcgaccgccgtcctgtccggaaaccgcaacttcgacggccgcatccacccccacgcc
aagcaggcgttcctcgcctcgccgccgctggtcgtcgcctacgccatcgccggcaccgtg
cgtttcgacatcgagcgggacgccctgggcgtggaccgggacggcaagccgatcacgttg
aaggacctgtggccgtccgacgcggagatcgatgccatcgtcgcctcctgtgtccggccc
gagcagttccgcgcggtgtacgatccgatgttcgcggcgaaccgcgacggtgttgaaaag
accagcccgctctacgactggcgcccggcgtccacctacatccgccggccgccctattgg
gacaccgaaggggtgggcgctttggccgccaccccgcgcaccctcaccggcatgcgcccg
ctggcggtgctgccggacaacatcaccaccgaccacctgtcgccgtcgaacgccatcctc
gccaattcggcggcgggtgaatatctggcgcggatggggctgccggaagaggatttcaac
tcctacgccacccaccgcggcgaccatctgaccgccctgcgcgccaccttcgccaacccg
cagctggtcaatgaaatggccgtggtggagggggcggtgaggaagggctcgctgacccgt
ttggaacccgacggcacggtcatgcgcatgtgggaggccatcgagacctacctggagcgc
cggcagccgctgatcgtcgtcgccggagccgactacggccaggggtcgagccgcgactgg
gccgccaagggtgtgcgtctggccggcgtcgaggccatcgtcgccgagggcttcgagcgc
atccaccgcaccaacctgatcggcatgggggtgctgccgctggagttcaagccgggcacg
acgcggctgacgctgggcctggacggcagcgagacctacgatgtgaccggcgaacgccgg
ccgcgcaccgacctgaccctggtcgtccatcgccgcgacggtgaaaccttgcgggttccg
gtgacatgccgcctcgacaccgccgaggaggtgtcgatccatgaggccggaggcgtgctg
caacggttcgcgcaggatttcctggcctcggaaagcgcgcagaaaggagccgcctga

DBGET integrated database retrieval system