KEGG   Azospirillum brasilense Az39: ABAZ39_27860Help
Entry
ABAZ39_27860      CDS       T03288                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00071  Fatty acid degradation
abq00072  Synthesis and degradation of ketone bodies
abq00280  Valine, leucine and isoleucine degradation
abq00310  Lysine degradation
abq00362  Benzoate degradation
abq00380  Tryptophan metabolism
abq00620  Pyruvate metabolism
abq00630  Glyoxylate and dicarboxylate metabolism
abq00640  Propanoate metabolism
abq00650  Butanoate metabolism
abq00900  Terpenoid backbone biosynthesis
abq01100  Metabolic pathways
abq01110  Biosynthesis of secondary metabolites
abq01120  Microbial metabolism in diverse environments
abq01130  Biosynthesis of antibiotics
abq01200  Carbon metabolism
abq01212  Fatty acid metabolism
abq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAZ39_27860
   00630 Glyoxylate and dicarboxylate metabolism
    ABAZ39_27860
   00640 Propanoate metabolism
    ABAZ39_27860
   00650 Butanoate metabolism
    ABAZ39_27860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABAZ39_27860
   00072 Synthesis and degradation of ketone bodies
    ABAZ39_27860
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAZ39_27860
   00310 Lysine degradation
    ABAZ39_27860
   00380 Tryptophan metabolism
    ABAZ39_27860
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABAZ39_27860
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAZ39_27860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABAZ39_27860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abq04147]
    ABAZ39_27860
Enzymes [BR:abq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABAZ39_27860
Exosome [BR:abq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABAZ39_27860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIB15685
UniProt: A0A060DSK1
Position
AbAZ39_p3:complement(224238..225431)
Genome map
AA seq 397 aa AA seqDB search
MMDATDPVVIVSAARTPLGRFQGELSTLPAHALGAHAVRAALSRAGLAPERVDEVLLGCV
LPAGQGQAPARQAARGAGLPDATGATTVNKVCGSGMKATMLAHDLIRAGSADLVVAGGME
SMSNAPYLLAKARGGYRIGHDRILDHLMLDGLEDAYEGGRPMGDFGEATADLYGFTRAEQ
DAYAVETLTRARAAIASGAFAAEIAPVTLAVKGGERTVADDENPLKVAPEKIPALKPAFR
RDGTITAASSSANADGAAALLLTRRSLAEREGLPVLATILGHATHSQDPAWFTTAPIPAI
RKLLDRVGWGVGDVDLFEINEAFAVVAMAAQRDLGIPRDALNVNGGACALGHPIGATGAR
LIVTLLHALAARGLRRGVASLCIGGGEATAIAVERPA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atcatggacgcaacggaccccgtcgtcatcgtgtccgccgcacgcacgccgctcggccgt
ttccagggggagctgtccaccttgcccgcccacgcgctgggtgcccacgccgtccgtgcc
gccctgagccgcgccgggctggcgccggagcgcgtggacgaagtcctgctcggctgtgtg
ctgcccgccggccaagggcaggcgccggcccggcaggcggcgcgcggcgccggtctgccc
gacgccaccggcgccaccaccgtcaacaaggtctgcggctccggcatgaaggcgacgatg
ctcgcccacgacctgatccgcgccggctccgccgacctcgtggtcgccggcggcatggag
tcgatgtccaacgcgccctatctgctggccaaggcgcgcggcggctaccgcatcgggcac
gaccgcatcctcgaccacctgatgctcgacgggctggaggacgcctatgagggcgggcgc
cccatgggcgatttcggcgaggcgaccgccgacctctacggtttcacccgcgccgagcag
gacgcctacgccgtcgagacgctgacccgcgcccgcgccgccatcgcaagcggcgccttt
gccgccgagatcgcgcccgtcaccctcgccgtcaaaggcggggaacggaccgtcgccgac
gacgagaacccgctgaaggtcgcgccggagaagattcccgccctgaagccggccttccgt
cgcgacgggacgatcaccgcggccagctcctcggccaacgccgacggggcggcagcgctt
ttgctcacccgccgctcgctggccgagcgcgaggggctgcccgtgctggcgaccatcctc
ggccacgccacccacagccaggacccggcctggttcaccacggcgccgattccggcgatc
cgcaagctgctcgaccgcgtcggctggggtgtcggcgacgtcgacctgttcgagatcaac
gaggccttcgcggtcgtcgccatggcggcgcagcgcgatctgggcattccgcgcgacgcg
ctgaacgtcaacggcggagcctgcgcgctcggccaccccatcggcgccaccggcgcgcgg
ctgatcgtgacgctgctgcacgcgctggcggcgcgggggctgcgccgcggcgtcgcctcc
ctgtgcatcggtggcggcgaggccacggccatcgcggtcgaacggcctgcctga

DBGET integrated database retrieval system