KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_00604Help
Entry
ABTJ_00604        CDS       T02045                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00071  Fatty acid degradation
abr00280  Valine, leucine and isoleucine degradation
abr00281  Geraniol degradation
abr00310  Lysine degradation
abr00362  Benzoate degradation
abr00380  Tryptophan metabolism
abr00410  beta-Alanine metabolism
abr00640  Propanoate metabolism
abr00650  Butanoate metabolism
abr00903  Limonene and pinene degradation
abr00930  Caprolactam degradation
abr01040  Biosynthesis of unsaturated fatty acids
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01120  Microbial metabolism in diverse environments
abr01130  Biosynthesis of antibiotics
abr01200  Carbon metabolism
abr01212  Fatty acid metabolism
Module
abr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABTJ_00604
   00650 Butanoate metabolism
    ABTJ_00604
  Lipid metabolism
   00071 Fatty acid degradation
    ABTJ_00604
   01040 Biosynthesis of unsaturated fatty acids
    ABTJ_00604
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABTJ_00604
   00310 Lysine degradation
    ABTJ_00604
   00380 Tryptophan metabolism
    ABTJ_00604
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABTJ_00604
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABTJ_00604
   00281 Geraniol degradation
    ABTJ_00604
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABTJ_00604
   00930 Caprolactam degradation
    ABTJ_00604
Enzymes [BR:abr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABTJ_00604
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABTJ_00604
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABTJ_00604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C Methyltransf_31 DUF5333 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFI94244
Position
complement(612167..614302)
Genome map
AA seq 711 aa AA seqDB search
MSAIQYEKNADNIVILTLDSTGQSANTMNAEFRDSLDEVTQKLKAESELSGVIFRSAKKT
FFAGGDLDELIQVQPEHATDFFNMVEKLKGHLRTIETLGVPVVAALNGTALGGGWEIALS
CHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSL
GLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLK
DKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLATGQISKNMIGTFWHGLNAIK
SGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPVILKDVSVENAEKGKAYSQKL
LDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIEAVFENQELKAKVTQEAEQYLA
PNGVMASNTSTLPITGLAQASKDDKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYD
FVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAI
QDEVSLTLTEHVASETRKALQAVGKELPKTPVDEVIHTMIHELNRKGKAAGAGFYDYPEN
GKKHLWEGLKRWQKDHDISEQDMIDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGY
APWTGGAIQFLNQYGIDKAKKRAEELAAKYGERFTPPTLLKTKAEQKQNIQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaattcaatacgaaaaaaatgccgacaatattgtcatcttgacacttgattca
actggtcagtctgcaaataccatgaatgcagaatttcgtgactcgcttgatgaggtcacc
cagaaacttaaagcagaatcagaactttcaggtgttatttttcgctcagcaaaaaaaact
ttctttgctggtggtgatttagatgaactgattcaagttcaacctgagcatgcaactgac
tttttcaatatggttgagaagttaaaaggtcatctaagaacgattgaaacactaggagtt
ccagttgttgcagcattaaatggcacggcactgggcggaggatgggaaatcgcattaagt
tgccatcaccgtattgcaatcaatgacccgaaaagtaaatttggcctaccagaagttacc
ttaggtttactaccgggcggcggtggtattgtacgtatggttcgtctgcttggtcttcaa
aatgcgttcccatttttaatggaaggcaaacagttcggtgtcgataaagcaaaatcttta
ggcttaattcatgacacagctgaaaatgaacaagaacttttagataaagcgattgcttgg
atcaaagccaatccaaaatctcaacagccttttgatgtgaagggttataaaattccgggt
ggcgatccaaaaactccggcagttgcacaagttctcgctattgcaccagccatgctaaaa
gacaaaaccaagggctgctatcctgctcctgaagcgattatggctgccgcagttgaaggt
gctcaagttgatgtcgataccgccttgcgcatcgagtctcgctactttactcaactagca
acaggccaaatttctaaaaatatgattggcactttctggcatggtctaaatgcaattaag
tcgggtgctagccgtcctgccgatattgcaaaatggcaagccactaaagtgggcgtgttg
ggtgcgggcatgatgggtgccggtattgcctacgccactgcaattaaaggcattcctgtt
atccttaaagatgtatctgttgaaaatgctgaaaaaggcaaagcatattcacaaaagctc
ttagataaacgtgtttcacaaggtcgcatgacggcagaaaaacgtgatcagattttatcg
ctcattacggccacagcttctgctgaagacttacaaggttgtgacctgattattgaagcc
gtatttgaaaaccaagagctcaaagcgaaagtcactcaagaagccgaacaatacttagcg
cctaatggtgtaatggcatcaaatacatccaccctaccgattacaggtttagcgcaagca
agtaaggatgataaagcatttattggcctgcatttctttagccctgtcgacaaaatgcag
ttggttgagattattaaaggtaaaaatacctccgcagagacacttgctaaagcctacgac
tttgtacagcaaattggaaaaacgccaatcgttgtcaatgatagccgtggcttctttacc
agtcgtgtgtttggtacttttattcaagaaggtatgcgcttacttgcagaaggcgtccat
ccagcgcgtattgaaatggcagcactgaaagctggcatgccggtaggaccacttgcgatt
caagatgaagtgtctttaactttaacggagcatgttgcaagtgaaacacgtaaggcacta
caagctgtaggcaaagagttaccgaaaacaccggtagatgaagtgattcataccatgatt
catgaattaaaccgtaaaggtaaagctgctggcgcaggtttttatgattatcctgaaaat
ggtaaaaagcacctatgggaaggcttaaaacgttggcaaaaagatcatgatatctccgag
caagatatgattgaccgtattttgtttgtacaagccttagataccttacgttgttatgaa
gaaggggtattagagtcagtgattgatgccaatgtcggttctatttttggaattggttat
gccccgtggacgggaggagcgattcaattcttaaatcaatatggtattgataaagcaaaa
aaacgtgccgaagagttggctgccaaatatggtgagcgcttcacgcctccaacgttacta
aaaactaaagcagagcagaagcaaaatattcaataa

DBGET integrated database retrieval system