KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01487Help
Entry
ABTJ_01487        CDS       T02045                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00071  Fatty acid degradation
abr00072  Synthesis and degradation of ketone bodies
abr00280  Valine, leucine and isoleucine degradation
abr00310  Lysine degradation
abr00362  Benzoate degradation
abr00380  Tryptophan metabolism
abr00620  Pyruvate metabolism
abr00630  Glyoxylate and dicarboxylate metabolism
abr00640  Propanoate metabolism
abr00650  Butanoate metabolism
abr00900  Terpenoid backbone biosynthesis
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01120  Microbial metabolism in diverse environments
abr01130  Biosynthesis of antibiotics
abr01200  Carbon metabolism
abr01212  Fatty acid metabolism
abr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABTJ_01487
   00630 Glyoxylate and dicarboxylate metabolism
    ABTJ_01487
   00640 Propanoate metabolism
    ABTJ_01487
   00650 Butanoate metabolism
    ABTJ_01487
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABTJ_01487
   00072 Synthesis and degradation of ketone bodies
    ABTJ_01487
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABTJ_01487
   00310 Lysine degradation
    ABTJ_01487
   00380 Tryptophan metabolism
    ABTJ_01487
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABTJ_01487
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABTJ_01487
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABTJ_01487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abr04147]
    ABTJ_01487
Enzymes [BR:abr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABTJ_01487
Exosome [BR:abr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABTJ_01487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: AFI95096
Position
complement(1549300..1550868)
Genome map
AA seq 522 aa AA seqDB search
MSKTTQENPAVENSAQEKVSNTSKSASNTAKHNSTTPKAATNTPKTTRTRSTTAPARSPR
SKSAASATPSTSSNVAAAPKATKTKTSVQQDKTMSQNTVRRVAILGGNRIPFARSNTAYF
KASNSDMLTAALNGLVERFNLQGKRIGEVVAGAVLKHSRDFNMTREVVLSTDLAPETPAY
DIQIACGTGLQAAFVVANKIALGQIDVGIAGGVDTTSDAPIAVGDGLRKVLLELNVAKTG
KDRLKALTKIDFKKLLDAPSNGEPRTGLSMGEHQAITALEWGITREAQDELAASSHQKLA
AAYERGFFDDLMTPFLGLNRDNNLRPDSTVEKLAKLKPVFGKGETATMTAGNSTPLTDGA
SVVLLASEEWAKENGHEVLAYLSFSETAAVDFIGKSGPKEGLLMAPAYAVPRMLKRANLK
LQDFDFYEIHEAFASQVLSTLKAWEDEKFCKERLGLDAPLGSIDRSKLNVNGSSLGAGHP
FAATGGRILATAAKLINEKGSGRALISICTAGGEGVVAIVEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgagaattctgctcaggaaaaagtgtca
aatacatcaaagtcggcttctaacacggctaagcataacagcactactcctaaagcagca
actaatacaccaaaaacgacacgtactcgttcaacgactgcacctgcacgtagccctcgt
agtaagagcgctgcttcagcaaccccgtctacatcttcaaatgtagctgcagcaccaaaa
gcaacaaaaaccaaaacttctgttcaacaggataaaaccatgagtcaaaacactgttcgc
cgcgttgcaatccttggtggcaaccgtattccatttgcacgttcaaatactgcctacttt
aaagcgtctaattctgacatgctgacagcagcattgaatggtttggttgagcgctttaac
ttacaaggtaaacgtattggcgaagttgttgcgggcgctgttttaaaacatagccgtgac
ttcaacatgactcgtgaagttgtattgagcacagatcttgctcctgaaactcctgcttac
gacatccaaattgcatgtggtacaggtttacaagcagcatttgttgttgctaacaaaatt
gcgcttggtcaaatcgacgtaggtattgcaggtggcgtagatacaacttctgacgcaccg
attgctgtaggtgatggtttacgtaaagttttacttgagcttaatgttgctaaaacaggt
aaagaccgtcttaaagctctaacaaagattgattttaaaaagcttcttgatgcaccaagc
aatggtgaaccacgtactggcctttcaatgggtgagcaccaagcaatcactgcattagaa
tggggtatcactcgtgaagcacaagacgagctagctgcaagcagccatcaaaaacttgct
gctgcttatgagcgtggtttttttgatgacttaatgactccattcttaggtcttaaccgt
gacaacaacttacgtcctgacagtacagttgaaaaacttgctaagttaaaaccagttttc
ggtaaaggcgaaactgcaacaatgacagcgggtaactcaactccgttgactgatggtgct
tctgtggtattgcttgcttctgaagaatgggcaaaagaaaacggacatgaagttttagct
tatctttctttctctgaaacagcagctgttgacttcattggtaagagcgggcctaaagaa
ggcttattgatggctcctgcttatgcagtacctcgtatgcttaagcgtgctaaccttaag
cttcaagacttcgatttctacgaaatccatgaagcatttgcatctcaagtactctctacc
ttaaaagcttgggaagatgaaaaattctgtaaagaacgtcttggcttagatgcaccattg
ggttcaattgaccgctctaaactgaacgtaaatggttcatctttaggtgcaggtcaccca
tttgctgcaactggtggtcgtatcttggctactgcagctaaattaattaatgaaaaaggt
tcaggccgcgcattaatctcgatctgtacagcaggcggtgaaggtgtggttgcgattgta
gaaaaataa

DBGET integrated database retrieval system