KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02201Help
Entry
ABTJ_02201        CDS       T02045                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00480  Glutathione metabolism
abr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABTJ_02201
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABTJ_02201
Enzymes [BR:abr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABTJ_02201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AFI95801
Position
complement(2272232..2272717)
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagagggagatattaaacaattcgct
gattacaaaggtaaagttttattaattgtaaatactgcaagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaaatataaagaccaaggtttagaagtttta
ggttttccctgcaatcagtttggtgggcaagatcccggaagcaataaagagataggtaca
ttctgccagcgtaactatggagtgaaattccctatgtttgccaaagtagatgtaaaaggt
cctgaagctcatgtgatctttagatatttaacccgtgaagcaaaaggaattttaggaagc
agtactattaaatggaactttaccaagtttttagtgggtaaagatggttcggttttaaat
cgttatgcgccaacaaccaagcctgaagcattggaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system