KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02401
Entry
ABTJ_02401        CDS       T02045                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
abr  Acinetobacter baumannii MDR-TJ
Brite
KEGG Orthology (KO) [BR:abr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abr02044]
    ABTJ_02401
Secretion system [BR:abr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTJ_02401
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFI95999
Position
complement(2481060..2482424)
AA seq 454 aa
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHIL
ALESVEMIWQDGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQS
QKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQ
SSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGD
IVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHH
NLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSS
VMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIELH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtttaaagctgaaaaagtcctgtggggtgaaggtttatttttaagacctcaacatttc
cagattcaagatacctatcatgaacaacgtttaaatcatacggttcgtgctgttgttcca
ttttcctatggcgttcaaaaacttagttttgatgaagcacagttaagtacgcatattctt
gcacttgaatcggtagaaatgatttggcaagatggtgaaatatatcaagcgcctgcttat
gacttattacctgaacctattttgcttgatgagcttaatttacgtggtgaaatggtcatc
tatttggcattaccattattacaagccaataaacaaaatttaatcgatcaaaatcaatca
caaaaggggcgctatcaatcacatttggttgagacccatgatctgttcacaaacgcgaca
gaggctgatatcagcttattacgtcgtcgagctgtgtttaaattattagatgcacatagt
aatcctgatcataatttagatggtttcctgtatttgccaataggcaaaattaaacgtcag
agttcaggtgcttttgaaattgaccgcaaatttattccgcccattttgcatgtcgatgca
tctgagaccttggtttcaaatttaaaaagaaccttgaatgttattaaggcaaaaattaaa
acgattcaaaccaataaccgagaaaatgagcagaaattaattgaattccgttcaggtgat
atcgtttcgttttggttggtaaatgctttaaatactgctcatgctggtctgagccatttc
ttgcaatatccgcaaattcatccggaacgattattctttgaattgctacgtttagcaggt
tcattattaaccttctcgacagcttatgaagttgatcagttacctgcatataaacatcat
aatttgcaagagagtttcacccagctcgacacaattttacgtgatttactcgatacgatt
atttcgagtcgttacatcagtattgcccttaaagaaattcgcccttcatattgggtggga
agtctcgaaaccgataagattactcgagataccagactttatattgctgtatcaagtagc
gtgatgcagacccatgagttgattcaaatcgttcctctacgttttaaaatcggtagtact
ttagatgttgaacaacgtgttgttgcagcattaccagcaattccattacaccacttaatc
caagttccaactgctattccagtacgttcgggtgtgagctattttgaaatcgaactgcat
catgaactctatcaacgtatgttggattcagaaacgatttgtatttatgttccggctgga
ttccaagatatcagtattgagctgattgcggtcatgaacgcttaa

DBGET integrated database retrieval system