KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02410
Entry
ABTJ_02410        CDS       T02045                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
abr  Acinetobacter baumannii MDR-TJ
Brite
KEGG Orthology (KO) [BR:abr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abr02044]
    ABTJ_02410
Secretion system [BR:abr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTJ_02410
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFI96008
Position
complement(2494733..2496544)
AA seq 603 aa
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI
DKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRS
FKGVQCEFNTTQEVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEK
LPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELLIHFKLNLNDQAVVRNYSELN
IANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQ
EESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGV
KAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGK
TLL
NT seq 1812 nt   +upstreamnt  +downstreamnt
gtgatagaagagcttttaccgttttatgaaaaacaattacaagaatttggtcaacaatct
cgagaatttgcccaaaaatatccaaaaattgctcagcgcttatctttaaatcaagagcaa
attgatgacccacatattgaacgtctgattcaggctttttcgctgattgctgctcgaatc
gataaaaaactaacagacagttacgatgtttttactcgttctttatttgaggtgatgttc
cctcaatacttacggcattttcctgcgtgttcagttgttagctttgaagatattaataag
attaaacagcttacagaacctcatcttgtacctcatcatacggttttgaaatctcgtagt
ttcaaaggagtacagtgtgagtttaatacaactcaagaggttaaattactacctattcat
ttaagtggtttagattttaaaactacacctagtgcacatatgcacttaaatcaaaatgcg
acgttgagccttaaatttgaaatttttaataatgctcatgcttgtttaactgatgagaag
cttcctatttatttggatgctatctctaattttcctctacaggtccttgatagtattttc
aaaaaaggaaccagttttgcggttaaatatggacaaacaattgtagaattgagcaagaat
ccatttgaattgattggttttgcagaacaagaaagtttattaccgcttgatcaacatacc
catcatgcttatcgtttgttgatggaatacttttgtttcccggaaaagtttagttatctt
aagctcgatttggattttttaaggcgactacctcagcatgtatccgaatttgagctttta
attcatttcaaattaaacttaaatgatcaagccgttgttagaaactattctgagctaaat
attgcaaactttaaattatttactacccccgtaattaatttatttgaaaaatatgctgaa
ccccagaagatagttcacaagcaattagaatatcctttagttacagacgctcaccatcct
gaattttatcaagtatattcaatacttgagatgaatatggtgcgtgaaaaaacaaatcag
gaagaaagctatgttcctgttttgcctttttttgcgatgagccattaccacaatgataca
gctcgctttttttactcagtaaactatcaaaagttacagtccaatttcgttgaaatgggc
tattcgattatttctaaaaatttaaatccattttcaacgcgctcagattttattagcact
aaattattatgttcaaaccgtgatttacctcatgaagcactgggtcagtctaataacgta
ttaaatttaaatgatagtagcttggcgagacgtgccattgttttaaaacgacctacaaag
ccttataagtttgaacaaggccaaagtgaacagtggcgtgtgatctcgcatctttcatta
aatagcttagcacttatgaaaggggatgctgtttctcatgttaaagagctgctggcttta
tataacttaccgcagtcaaaagaaaactatttaattatagaatcaattaaaaaattagaa
ttttctcttacccataaactcgtagatggcaaaccatttccaatgtttgtaagaggagta
aaagctgaattacaaattgattcatccgtatttagagggcatagcttatatatttttagt
cagttattaagtcgtgtttttaatttaaaggttcaaattaatagttttgttgatttggtg
gttaaggattattcatctcagcaggagttataccaatgcagtcagaacgttggtggcaag
actcttctgtaa

DBGET integrated database retrieval system