KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02414Help
Entry
ABTJ_02414        CDS       T02045                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
abr  Acinetobacter baumannii MDR-TJ
Brite
KEGG Orthology (KO) [BR:abr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abr02044]
    ABTJ_02414
Secretion system [BR:abr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTJ_02414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA DUF29
Motif
Other DBs
NCBI-ProteinID: AFI96012
UniProt: A0A454AXT2
Position
complement(2499144..2499647)
Genome map
AA seq 167 aa AA seqDB search
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctcctcgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggcagttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaacagt
gagcgtttagaagatctgcttgatgaggttcttaaaaatactgatcaaatccgtaaatta
agtgccgaggccgatcatgaataa

DBGET integrated database retrieval system