KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02906Help
Entry
ABTJ_02906        CDS       T02045                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00860  Porphyrin and chlorophyll metabolism
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01120  Microbial metabolism in diverse environments
Module
abr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABTJ_02906
Enzymes [BR:abr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ABTJ_02906
Exosome [BR:abr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABTJ_02906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFI96496
Position
2983917..2985014
Genome map
AA seq 365 aa AA seqDB search
MGLQYSSRLTVMEYPPTYPSVIPNIEIVMTYTFNRPAFPATRMRRIRKNDQLRAMVSETQ
LTTNHLIYPVFVLPGQNQTQDIPSMPNIQRLSADLLLKKAERLLELGVSKLALFPVTPQE
DKSLTAEAAWREDGLVQTTCRLLKKELPEMVLITDGALDPYTTHGQDGIIDETGYVLNDE
TVECLIKQALSHAEAGAEVIAPSDMMDGRIGAIRQALEANGHIYTNIMAYSAKYASSFYG
PFRDAVGSASNLKGGNKYNYQMDFANRAEALHEIALDIQEGADMVIVKPGMPYLDVVREV
KDTFGIPTFIYQVSGEYAMLAGAIQNGWLSDSVILESLMCCRRAGADGIWTYFAETAAEK
LKEMN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggctacaatacagcagtcggttgacagtaatggaatatccgccaacctatcctagt
gtaataccgaacatcgagattgttatgacttatacgttcaatcgtcctgcatttccagct
actcgcatgcgccgtatccgtaaaaatgaccagttgcgtgcgatggtcagcgaaacacag
ctcactaccaatcacttgatttatccagtatttgtattaccgggacaaaatcaaacccaa
gatattccaagtatgccaaacattcagcgtttgtcggcagatttattactgaaaaaagct
gaaagacttctggaattaggtgtatccaaactggctcttttccctgtaacacctcaagaa
gataaaagccttaccgcagaagctgcatggcgtgaagatggtttagttcaaaccacctgc
cgtttgcttaaaaaagaattgccagaaatggtgttaatcaccgatggtgccctcgaccca
tacacgactcatggtcaagacggcattattgatgaaactggctatgtgctcaatgacgag
actgtagaatgcttgattaaacaagcattaagtcacgctgaagctggtgccgaagtgatt
gcaccaagtgacatgatggatggccgtattggcgcgattcgtcaggctttagaagccaat
ggtcacatctataccaacatcatggcctactctgcgaaatatgcgtctagcttctatggt
ccgttccgcgatgctgttggctctgcatccaacctcaaaggtggtaataaatataactac
cagatggattttgccaaccgtgccgaagcattacatgaaatcgcgcttgatattcaagaa
ggcgccgacatggtgattgtaaaaccgggcatgccatatctggatgtggtacgtgaagtg
aaagatacctttggtattccgacattcatttaccaagtgagtggcgaatacgcaatgtta
gctggcgcaattcaaaatggctggttatcagactcagtgattttagaatcgctcatgtgc
tgccgccgcgctggtgcagacggaatctggacttactttgcagaaaccgctgctgaaaaa
ctcaaggaaatgaactaa

DBGET integrated database retrieval system