KEGG   Acholeplasma brassicae: BN85304700Help
Entry
BN85304700        CDS       T03095                                 

Gene name
bglX
Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
abra  Acholeplasma brassicae
Pathway
abra00460  Cyanoamino acid metabolism
abra00500  Starch and sucrose metabolism
abra01100  Metabolic pathways
abra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN85304700 (bglX)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BN85304700 (bglX)
Enzymes [BR:abra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BN85304700 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: CCV65491
UniProt: U4KMV4
Position
530458..532581
Genome map
AA seq 707 aa AA seqDB search
MKDLVSTLTLEEKIGQLIQIAPFFYIEKIDKNVFGPLLDLGISEEEIFLTGSVLGIKDAE
EMIEVQKTYLEKSRHKIPLMFMADIIHGYKTIFPVPLAMAAAFNPNLVKKAARISSIEAQ
TAGIHVTFSPMADLTRDPRWGRVVEGFGEDPYLNGVLAASMVQGYQHDGIDKEGNLASCV
KHFAGYGLSEAGRDYNTTDVSRLNLHQYYLTGYKKALDAGARLVMTAFNLIEGVPATTNA
YLLREVLRDQYQFDGVVISDYDSLKETIEHGTSKDEKDAARQGIIAGLDIEMATAAYFRN
LPALIQENKVDIALIDEAVLRVLELKRDLGLFDNPYKGASVTKAKQLVLSEAHKKASLEV
ALESAVLLKNDGGTLPLKKEMRVALLGNYATSKDTIGPWSWHGNPSDNNSLDDVLNGYAA
SLYVNDTLEAHLLDETSINDSDILVVAIGESRRESGEAHSKTNIKLSNQQERFINDLKQF
NKKIVLVLFNGRPLDLSGVIDQSNAILETFFLGTCSSEAIAMLLYNEKNPSGKLPMSFPR
NVGQVPIYYNYLNTGRPYKNDGNEYTSFYLDEKNDPLFSFGYGLSYSQFEFSNLIVKNAV
FYKGETFQFSIDVTNTSAFDGYEVVQVYLRDLVAEVSRPVKELKAFNKVFVKKNETVTLE
FLLDDEAFSYVHRDLSFESDAGDFILYVGNSSTSTLETKITMKEGKL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttagttagcacattaacacttgaagaaaaaattgggcaattaatccaaatt
gccccgttcttctacattgaaaaaatcgataaaaacgtctttggaccactcttagatctt
gggattagtgaagaagaaatcttcttaaccggttctgttttaggcatcaaagacgcagaa
gaaatgattgaggttcaaaaaacctatttagaaaaatccagacacaaaatcccactcatg
tttatggctgacatcatccatgggtataaaaccatttttcctgtgccattggcaatggcg
gccgcttttaacccaaatttggttaaaaaggcagcacgtatttcaagtatcgaagcacag
acggctggcatccacgtcaccttctcaccgatggcagacttaaccagagacccaaggtgg
ggcagagtcgttgaaggctttggggaagatccatacttaaatggtgtattagcagcaagt
atggttcaaggttatcaacacgatggcatcgataaagaaggtaatttggctagctgtgtg
aaacactttgctggctatggtttgagtgaagcaggtagagactacaataccacagacgtc
tcaagactaaacctacaccagtactacctcaccgggtataaaaaagcactagatgcaggt
gcaagacttgtgatgactgcctttaatttaattgagggtgtacctgccaccacaaacgcc
tacttactgcgtgaggtcttaagagaccaataccagtttgatggggtggtcatttcggat
tatgattcattaaaagagaccattgaacatggcacctcaaaagatgaaaaagacgcggca
agacaaggcatcattgccggtcttgatattgaaatggcaacggcagcatattttagaaac
ctaccagccttaattcaagaaaacaaagtcgatatcgctctcatcgatgaagccgttttg
agagttttagaactcaaaagagacttaggcttatttgataacccttataaaggggcatcc
gttacaaaggctaaacaattggtcttatcagaggcgcataaaaaggcaagcttagaagtt
gccttagaatcggcagtcttgttaaaaaatgacggtggcacactgccacttaaaaaagag
atgagggtagccctgcttggaaactacgcgacctcaaaagacacgatcggtccgtggagt
tggcatggtaaccctagcgataacaacagcctagatgacgtcttaaatggttatgctgcc
tcactttatgtgaatgacaccttagaagctcatttgttagatgaaacaagcatcaatgat
tcagacatacttgtggttgcgattggtgaatcaagaagagaaagtggcgaagcccacagc
aaaacaaacataaagctttcgaaccaacaagaacgctttatcaatgacttaaaacagttc
aataagaagattgttttagtcttgtttaatggtagaccccttgatttaagtggggtaatt
gaccaatcaaatgccatcctagagacgttctttttaggcacctgttcaagtgaggcgatt
gcgatgcttttatataatgaaaaaaacccttcaggcaaactgccgatgagttttccacga
aacgttggtcaagtaccaatctactataactatttaaatacgggccgtccgtataaaaac
gatggcaacgaatacacctcattctacctagatgaaaagaatgacccactgtttagtttt
ggctatggtttatcgtatagtcaatttgaattttcgaacttaatcgtcaaaaatgctgtt
ttttataaaggcgaaacgtttcaattttcaattgatgtgacaaacacctcagcgtttgat
ggctatgaagtcgttcaagtgtacttaagggatttggtcgcagaagtctcaagacctgtc
aaagagttaaaagcctttaacaaggtattcgttaagaaaaacgaaaccgtcacactagag
tttctgctagacgatgaagcattttcatacgtgcacagagatttaagcttcgagagtgac
gctggggatttcatcctatacgtgggtaatagttcaacaagtaccctagaaacaaaaata
acaatgaaagaaggtaagctttga

DBGET integrated database retrieval system