KEGG   Acholeplasma brassicae: BN85309340Help
Entry
BN85309340        CDS       T03095                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abra  Acholeplasma brassicae
Pathway
abra00071  Fatty acid degradation
abra00280  Valine, leucine and isoleucine degradation
abra00310  Lysine degradation
abra00362  Benzoate degradation
abra00380  Tryptophan metabolism
abra00620  Pyruvate metabolism
abra00630  Glyoxylate and dicarboxylate metabolism
abra00640  Propanoate metabolism
abra00650  Butanoate metabolism
abra00900  Terpenoid backbone biosynthesis
abra01100  Metabolic pathways
abra01110  Biosynthesis of secondary metabolites
abra01120  Microbial metabolism in diverse environments
abra01130  Biosynthesis of antibiotics
abra01200  Carbon metabolism
abra01212  Fatty acid metabolism
abra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN85309340 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN85309340 (atoB)
   00640 Propanoate metabolism
    BN85309340 (atoB)
   00650 Butanoate metabolism
    BN85309340 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN85309340 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BN85309340 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN85309340 (atoB)
   00310 Lysine degradation
    BN85309340 (atoB)
   00380 Tryptophan metabolism
    BN85309340 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN85309340 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN85309340 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN85309340 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abra04147]
    BN85309340 (atoB)
Enzymes [BR:abra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN85309340 (atoB)
Exosome [BR:abra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN85309340 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCV65955
UniProt: U4KNS9
Position
complement(1022865..1024079)
Genome map
AA seq 404 aa AA seqDB search
MSNKVYIVGAKRSPIGSFLGTLKDLHPAEIGVQVLKQLFIESKIPRDQIDEVIVGNVIQA
GLGQNVARQIAIKSGVPQEVPAYTVNMVCGSGMKTVMNAYVSIKAGMSNLVVAGGVESMS
YAPYIVDAKIRSGNKMGNLEMKDSILKDALHDSFTEGMHMGITAENIASKHGLSREALDQ
FAYESQQKAIKAVDEGRFKDEIVPIEIKTRKETIIFDQDEYPNRQTSLEKMTKLRPAFKS
DGLVTAGSSSGINDGASFVILASESAVKAHNLTVIAEVVGIGQAGVDPNVMGLGPVPAVK
HALNHANLKLSQIDLVELNEAFASQSLGVIEEVIAEHHVDKETFMQKTNVNGGAIALGHP
VGVSGNRIIVTLVHEMKKRSLTYGLASLCIGGGMGTALIIKRGE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaagtatatattgtaggtgcaaagagaagtccaatcggcagttttcttggt
acgttaaaggatttacacccggcggaaatcggtgtgcaagtgttaaaacagcttttcatc
gagtctaagataccaagagatcaaatcgatgaagtgattgttggtaatgtgatccaagcc
ggtttaggacaaaacgttgctagacaaattgcgatcaaatcaggtgtacctcaagaagtg
ccagcctacactgtcaatatggtctgtggtagtggtatgaagaccgtgatgaacgcatac
gtgagtataaaagcaggtatgtctaatttggttgttgctggtggggttgaatccatgagc
tatgcaccgtatattgtcgatgctaaaatacgcagtggtaataagatggggaacttggaa
atgaaggattcaatcttaaaggatgcgcttcatgactcgtttactgaaggcatgcatatg
ggcatcactgctgaaaatattgcgtctaaacatggtctttcaagagaagcactcgatcaa
tttgcttacgaaagtcaacaaaaggcaatcaaagcggtagacgaaggtcgtttcaaagat
gaaattgttccaatcgagattaaaacaagaaaagaaacaataatatttgatcaagacgaa
tacccaaaccgtcagacaagtttagaaaagatgacaaaacttcgtccagcgtttaaatca
gacggtcttgtgactgccggttcatcctctggaattaatgatggtgcaagctttgtgata
ttagcaagcgaatcagcggttaaagcacataatttgacggtgattgctgaggtcgtaggc
attggacaagcaggtgttgatccaaatgtgatgggcttaggtccagttccagcagtgaaa
catgcgcttaatcatgcgaatttaaaactaagtcaaattgatttagttgaacttaatgaa
gcattcgcttcacaaagtttaggtgtgattgaagaagtgattgctgaacaccacgtcgat
aaagaaacatttatgcaaaagaccaatgtgaatggtggggcaattgcactaggacaccct
gttggtgtttctggtaaccgtattattgttacgttggtgcatgaaatgaaaaaaagaagt
ctgacttatggcctcgctagcctttgtattggcggcggcatggggacagcgctcataatt
aaaagaggagaataa

DBGET integrated database retrieval system