KEGG   Acholeplasma brassicae: BN85310570Help
Entry
BN85310570        CDS       T03095                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abra  Acholeplasma brassicae
Pathway
abra00480  Glutathione metabolism
abra00590  Arachidonic acid metabolism
abra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN85310570
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN85310570
Enzymes [BR:abra01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN85310570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCV66078
UniProt: U4KRU7
Position
1154710..1155180
Genome map
AA seq 156 aa AA seqDB search
MIYDFNATTIDGKEVSLSKYKGKVLLIFNSATGCGFTPQYEGLEKLYETYKDKGLELLDF
PSNEFGNQAKGSNEEIKSFCSLNYDIRFDQFQKTTVNGKNANPLFKYLKSQRRSMFGTSI
KWNFTKFLVDKNGKVVKRYAPTTTPDKIEKDLVSLL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgactttaacgcaacaacgattgatggcaaagaagtttccttatctaagtat
aaaggaaaagtacttcttatatttaacagtgcgaccggttgtggttttacaccacaatac
gagggtttagaaaaactttatgagacctacaaagacaaaggacttgaattacttgatttt
ccatcaaatgaatttggaaaccaagctaagggatcgaatgaggagattaaatccttttgc
agtctaaattacgacatcagatttgatcaatttcaaaaaacaacggtcaacggaaaaaat
gcaaatccattatttaaatacttaaaatcacaaagacgttcgatgtttggcacctccatt
aaatggaacttcacgaagtttttagttgataagaatgggaaagtcgttaagcgttatgca
cctacaacgacacctgataaaattgaaaaagatcttgtctcattgttataa

DBGET integrated database retrieval system