KEGG   Acidianus brierleyi: DFR85_03140Help
Entry
DFR85_03140       CDS       T05472                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
abri  Acidianus brierleyi
Pathway
abri00860  Porphyrin and chlorophyll metabolism
abri01100  Metabolic pathways
abri01110  Biosynthesis of secondary metabolites
abri01120  Microbial metabolism in diverse environments
Module
abri_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:abri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DFR85_03140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abri01007]
    DFR85_03140
Enzymes [BR:abri01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DFR85_03140
Amino acid related enzymes [BR:abri01007]
 Aminotransferase (transaminase)
  Class III
   DFR85_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AWR93757
UniProt: A0A2U9ICL9
Position
complement(606521..607801)
Genome map
AA seq 426 aa AA seqDB search
MEMLNTEKSRSFYEEAIDHVPMGVNSNYRLVLNYPLYLKRGKGSKVWDVDGNEYIDFNMA
YGAMEVGYGNPLIVNEVVKTVEEGSILGFEYCKAIELAKIIKKRYNVDMVRFSSTGTEAT
MHSIRIARAYSRKKKIIKFEGHYHGSHDQLLVNVDPEKSMVKLPSSEGIPEEVIKNTLIA
EWNNLESFEKIIRENKDIGAVIMEPIAMNMGLIPPDKDFLKGVVELSRENNITVIFDEIK
TGGKSFSGASDYVEVEPDIKVIGKSIAGGLPLSVIAGKREVMSILNSGRVAHGGTFNANP
LSVRAAIVTLEKILTENAFYKMKRLNRMLTRGYNDIIEDLSLEASISSLAISGTIYFHNK
VPKNYSEFLNVDVEKWRNYFSKMMGRGIIPMADYDEQWTLSIAHDEKDIENHLTIAENTL
KEIKSL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggagatgctaaacacagagaagtctagatctttttatgaagaagctattgaccatgta
cctatgggcgtaaatagtaactatagattagtattgaactatcctctttacctaaagcga
gggaaaggaagcaaagtatgggacgtggatggaaacgaatacatagacttcaacatggca
tacggcgctatggaagtaggttatggaaatccattaatagttaacgaagtcgttaaaact
gttgaagaaggttctattcttggttttgagtattgtaaggctattgaattagctaagata
attaagaaaaggtataatgttgacatggtaagattctcttcaacaggcacagaagcaaca
atgcactcaataagaatagcaagagcatactcaagaaaaaagaaaataataaaattcgaa
ggacactaccacggatcacacgaccaattactagtaaacgtagatccagaaaaatctatg
gtaaaactaccttcttcagaaggtattcctgaggaggtaattaaaaatactttaatagca
gaatggaataatctagaatcattcgaaaaaataataagagaaaacaaagacataggagca
gtaataatggaaccaatagcaatgaacatgggactaatacctccagataaggactttcta
aagggtgtagtggagttatccagagaaaataatatcacagtaattttcgacgaaataaag
actggaggaaaatctttttctggagcttcagactacgtcgaagttgaaccagatattaaa
gtaataggtaaatctatagctggaggtcttcctttatcagtaatagcaggaaagagagaa
gtaatgagtatattaaattcaggtagggtagctcatggtggtacttttaatgctaatcct
ctttcagtaagagctgcaattgtcaccttagagaaaattctaacagaaaacgcattctat
aaaatgaaaagactaaatagaatgttaactagaggctataatgatataattgaagatctg
agcttagaagcatcaatttcatcactagctataagtggaacaatatatttccataataaa
gttcctaaaaactattctgaatttcttaatgttgacgtagaaaaatggaggaattacttc
tcaaaaatgatgggaagaggaataatacctatggcagattacgatgaacaatggacttta
tctatagctcatgacgagaaagatatagagaatcatctcactatagcagaaaatacatta
aaagagattaaatctttatag

DBGET integrated database retrieval system