KEGG   Acidianus brierleyi: DFR85_05865Help
Entry
DFR85_05865       CDS       T05472                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abri  Acidianus brierleyi
Brite
KEGG Orthology (KO) [BR:abri00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DFR85_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PsbH
Motif
Other DBs
NCBI-ProteinID: AWR94187
UniProt: A0A2U9IDT0
Position
complement(1126677..1127636)
Genome map
AA seq 319 aa AA seqDB search
MFIFGILIFLVGLISAFIVGGNNSATALGILISTNALKRKYSYLVSALSVFIGTALGSYT
MASSIYGEIKGSQIYVQVSIFSVIFASIIAFYYLNKSGIPSSLSQMIYPSLAVLVLVSKV
LYFNWFKFWFTVASWGFSPLLAIVSALVMYYILRRLTSKEKRVIREMKIYKSLIIASSIF
TSFVTGANAVGIIVSAGLIALPYYIVAPLYALAAAMGIYLSSKKASIVVGFKVTRLGYVS
ATSALLGSDIISEIFTIFGIPISITQTTMGGIIGLSFRSFGYDVEKQLKQVAKGWGTSPF
IAIIASLAAFGIIKSILGL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttatatttggtatcctaatatttttggttgggctaatatctgcatttatagtaggt
ggaaataactcagcaacagccctaggaatattaatatcaaccaatgcactaaaaagaaaa
tattcatacctagtaagtgctttgagtgttttcataggtacagccctaggaagttacaca
atggctagtagtatatatggtgaaataaagggaagtcaaatatatgttcaagtctcaatt
ttttcagttatttttgcttctattatagcattctattatttaaataaatcaggaattcct
tcttctttaagccaaatgatttatccctcgttagctgttttagtattagtatcaaaagtt
ctctacttcaattggtttaagttttggtttactgtagcctcttggggattctctccatta
ttggctatagtttcagctcttgtaatgtactatatattaaggagacttacttctaaagag
aaaagagtaataagagaaatgaagatttataagtctctaataattgcctcctccattttt
acgtcctttgtaacaggagctaacgcagtgggaataatagtttctgcaggtctaattgca
ctaccgtattatatagtagctcctttgtatgcattagctgcggctatgggaatatacctt
agttcaaaaaaagcttcaatagttgttggtttcaaagtaaccagactaggctatgtaagt
gccacttccgcacttttaggaagtgatataatttcagaaatttttacaatattcggtata
cctatatctataacgcagacaaccatggggggaataataggccttagttttagaagtttt
ggatatgatgttgagaagcagttaaaacaagtagctaaaggttggggaacttctccgttt
atagccataattgcttctttagccgcttttggtataataaaaagtattctagggttatga

DBGET integrated database retrieval system