KEGG   Acidianus brierleyi: DFR85_14750Help
Entry
DFR85_14750       CDS       T05472                                 

Definition
(GenBank) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K18978  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+] [EC:1.2.1.90]
Organism
abri  Acidianus brierleyi
Pathway
abri00010  Glycolysis / Gluconeogenesis
abri00030  Pentose phosphate pathway
abri01100  Metabolic pathways
abri01120  Microbial metabolism in diverse environments
abri01200  Carbon metabolism
Module
abri_M00633  Semi-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:abri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DFR85_14750
   00030 Pentose phosphate pathway
    DFR85_14750
Enzymes [BR:abri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.90  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+]
     DFR85_14750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AWR95657
UniProt: A0A2U9IHZ4
Position
2723337..2724860
Genome map
AA seq 507 aa AA seqDB search
MVSLNELSEEFKSIYVIDNDGIPLFKTYLLGEWVDAKDVQYLKSPIDLSVYAKVPKLNHE
MIDSTLSVMYKVGKWEIRDIPGEKRLKIYHKIADLLDKYRDDFINVLMIGNGKTKAQANG
EINASIERLIRADLDVRKLYGEYVPGDWSTESLESEAIVRREPLGIVLGITPFNYPLFDV
INKFVYSTVAGNAFILKPASSTPLPAIMLAKLAEIAEFPKRALSIITIQGNEMDKIISDK
RINVITFTGSSESGEQVIKSGGLKQYIMELGGGDPAIVLGDADPKIAAQRIASGITSYSG
QRCDSIKFIFAEASIYEQLKNYLIEELKKIKVGDPRESNTAMGPIIDPNTVQEFEYAVKD
AVNKGATILYGGNILGPTYIEPTLLEVDKKVLKELYLFRKEVFLSIATLTKVDNIDEAIE
LNTERRYGLDAAIFGNDIFKIRKALRRLEVGAIYINDYPKHGIGYFPFGGRKDSGTGREG
IGYTIEYVTSYKTLVYNYKGKGIWEYI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtttaaatgaactttcagaagagttcaaaagtatatacgtaatagacaatgat
ggaattcctttatttaaaacatatttattaggagaatgggtcgatgcaaaagacgttcag
tacttaaaatctccaattgatctttctgtctatgctaaggttccaaaattaaatcatgaa
atgattgattctacgctaagtgttatgtataaggttggcaaatgggaaataagggacata
ccaggagaaaagagattgaaaatatatcataaaatagcagatctattagataaatataga
gacgacttcataaacgtcctaatgattggaaatgggaaaactaaagctcaagctaacggt
gaaatcaatgcatcaatagaaaggttaataagagcagatcttgatgtgagaaaactatac
ggtgagtacgttcctggagactggagcaccgaaagtttagaatcagaagctatagtgagg
agggagccgctaggaatagtgctaggtataactccttttaattatcccctctttgacgta
attaataaatttgtatactctacagtagcaggtaatgcatttattttaaaaccagctagt
tctacaccattaccagcaataatgcttgctaaattagcggaaatagcagaatttcccaaa
agagcgttatcaataataacaatacaaggtaacgagatggataaaataatttcagataag
agaattaatgtaataacgtttactggtagtagtgaatctggagaacaagtaattaaatct
ggtggattaaaacaatacataatggaactgggtggtggtgaccctgctatagtgttggga
gatgcggatcctaagatagctgctcaaagaatagcttctggaataacaagttattctgga
caaagatgtgactctataaaatttattttcgctgaggcatcgatctatgagcaattaaaa
aattatctcattgaagaattgaagaagattaaagtaggagatccaagagaatccaatact
gctatgggaccaataatagatccaaatactgttcaagaattcgaatatgcagtaaaggac
gcagtaaataaaggtgctactattctttatggaggtaacattttaggtcctacttacatt
gaaccaactttgctagaagtagataagaaagtactcaaagaattatatttatttagaaag
gaagtgtttttatctatagctacgctaactaaagtagacaatatagacgaggcaatagaa
ctgaatactgagagaagatatggtctagatgcagcaatatttggtaacgatatttttaag
attaggaaggcactaaggagactagaagttggggcaatatacattaatgattatccaaag
cacggaataggatattttcccttcggaggaagaaaagattcaggaactggtagagaaggt
atagggtacacaatagaatacgtaacttcttataaaactttagtatataactataaagga
aaaggtatttgggaatatatctag

DBGET integrated database retrieval system