KEGG   Azospirillum brasilense Sp245: AZOBR_100391Help
Entry
AZOBR_100391      CDS       T02152                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00561  Glycerolipid metabolism
abs00640  Propanoate metabolism
abs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AZOBR_100391 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AZOBR_100391 (gldA)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AZOBR_100391 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCC98005
UniProt: G8AL93
Position
complement(1653747..1654841)
Genome map
AA seq 364 aa AA seqDB search
MITTAIFPARYVQGNGALDSLGEDLARLGKTVLAVTDSFVLKTLKGRLVEAAAGRVEMNI
QEFRGECSDEEIERLTGLARAMGADVVAGIGGGKALDTAKAVAHALNARTAIVPTLASTD
APCSALSVIYTPEGAFKRYLVLPRNPDLVLVDTGVVASAPVRFLVSGMGDALSTWFEAED
CRIKRGGNMTGRVGPMTAFALARLCYDTLLEYGVLAKSACEQGVVTPALERIVEANTLLS
GLGFESGGLAAAHAVHNGLTALEETHHCWHGEKVAFGTLTLLILTDRPPAVLDEVYGFCK
AVGLPTTLAEIGLAGVSDERLLLAAERACAEGETIHNEPHEITPQRVLAAMKAADAEGRR
RKGL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccacggcgatctttccggcccgctacgtccagggcaacggcgccctcgacagt
ctgggcgaggatctggcccggttgggcaagacggttctggccgtcaccgacagtttcgtc
ctgaagacgctgaaaggccggctggtcgaggccgccgctgggcgcgtcgagatgaacatc
caggaattccgtggcgagtgctccgacgaggagatcgagcggctgaccggcctcgcccgc
gccatgggcgccgacgtcgtggccggcatcggcggcggcaaggcgctcgacaccgccaag
gcggtcgcccacgcactgaacgcgcgcaccgccatcgtcccgacgctcgcctccaccgac
gcgccgtgcagcgccctgtcggtgatctacacgccggagggggcgttcaagcgctacctc
gtgctgccgcgcaaccccgacctcgtgctggtcgacaccggtgtggtggcgagcgcgccg
gtgcgcttcctcgtctccggcatgggcgacgccctgtccacctggttcgaggcggaggac
tgccgcatcaagcgcggcggcaacatgaccggacgcgtcggcccgatgaccgccttcgcg
ctggcccggctgtgctacgacacgcttctggagtatggcgtgctcgccaaatcggcctgc
gagcagggcgtggtcaccccggcgctggagcgcatcgtcgaggccaacacgctgctgagc
gggctgggcttcgagagcggcggactggcggcggcgcacgccgtccacaacggcctgacc
gcgctggaggaaacgcaccattgctggcacggcgaaaaggtcgccttcggcacgctgacc
ctgctgatcctgaccgatcggccgcccgcggtgctggacgaggtctacggcttctgcaag
gcggtggggctgccgacgacgctggccgagatcggccttgccggcgtgtcggacgagcgg
ctcctgttggcggcggagcgggcctgcgccgagggcgagaccatccacaacgagccacac
gagatcaccccgcagcgcgtcctggccgccatgaaggccgccgacgccgagggacggcgg
cggaagggcctgtag

DBGET integrated database retrieval system