KEGG   Azospirillum brasilense Sp245: AZOBR_140192Help
Entry
AZOBR_140192      CDS       T02152                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00860  Porphyrin and chlorophyll metabolism
abs01100  Metabolic pathways
Module
abs_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZOBR_140192 (cobQ)
Enzymes [BR:abs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AZOBR_140192 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: CCC98462
UniProt: G8AMK0
Position
2061399..2062856
Genome map
AA seq 485 aa AA seqDB search
MPRAIMLQGTGSDVGKSLLVAGLCRALVRRGLTVRPFKPQNMSNNAAVTADGGEIGRAQA
LQARACGVAPSVHMNPVLLKPQSDVGSQVVVRGVVAGTARAGDYQSRKGQLLPTVLDSFE
RLKAEADVVVVEGAGSPAEVNLRAGDIANMGFATAAGVPVVLVGDIDRGGVIASLVGTHA
LIPPEERALVAGFLINKFRGDVRLFDGGLSVIAERTGWPSFGVVPWLADAALLPAEDAVA
LDTWKTRSGGRLRVAVPMLSRIANFDDFDPLAQEPDVALSMVPRGQPLPGDADLVILPGS
KATIADLAVLRAQGWDVDLTAHRRRGGRVLGICGGYQMLGRRVADPDGIEGPPGEAEGLG
LLDVDTVLKGPKVLEEATGTETLTGAAVAGYEMHMGRTEGADRARPMLTLANGQTDGAVS
ADGRVMGCYLHGLFGADGFRAAFLTGLGAETSGQSYAATVEQALDRIAARLEEHVDIAAL
LAAAR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgcgatcatgctccaaggcaccggctccgacgtcggcaagtcgctgctggtg
gccgggctgtgccgggcgctggtccgccgcggcctgaccgtgcggcccttcaagccgcag
aacatgtccaacaacgccgccgtcaccgccgacggcggcgagatcggacgcgcccaggcg
ctccaggcgcgggcctgcggggtggcgccgtccgtccacatgaacccggtgctgctgaag
ccgcagtcggacgtcgggtcccaggtggtggtccgcggcgtcgtggcgggcacggcgcgg
gccggcgactaccagtcgcgcaaggggcagcttctccccaccgtgctcgacagcttcgag
cgtctgaaggccgaggctgacgtggtggtggtcgagggcgcgggcagcccggccgaggtc
aatctgcgggccggcgacatcgccaacatgggattcgccaccgcggcgggcgtgccggtg
gtgctggtcggcgacatcgaccgcggcggggtgatcgccagcctcgtcggcacccacgcc
ctgattccgccggaggagcgggcgctggtcgccggcttcctcatcaacaagttccgcggc
gacgtgcggctgttcgacggcggcctgtcggtcatcgcggagcgcacgggctggccgagc
ttcggcgtcgtgccctggctggccgacgccgccctgctgccggcggaggacgcggtggcg
ctggacacctggaagacccgctccggggggcggctgcgcgttgccgtgccgatgctgtcg
cgaatcgccaacttcgacgatttcgacccgttggcccaggagccggacgtggccctgtcc
atggtgccgcgcggccagccgttgccgggcgacgccgatctggtcatcctgccgggcagc
aaggcgaccatcgccgatctggcggtgctgcgcgcccagggctgggacgtcgatctcacc
gcccatcgccggcgcggcgggcgggtgctgggcatctgcggcggctaccagatgctcggc
cggcgagtcgccgatccggacggcatcgagggaccgccgggcgaggccgaggggctgggc
cttctggacgtggacaccgtgctgaaggggccgaaggtgctggaggaggcgaccgggacg
gagaccctcacgggggccgcggtcgccggctacgagatgcacatgggccgcacggaaggg
gcggaccgcgcacgcccgatgctgaccctggcgaacggacagaccgatggcgcggtgtcc
gccgacgggcgggtgatgggctgctacctgcatggcctgttcggggcggacggcttccgc
gccgccttcctgacggggttgggggccgagacgtccggccagtcctacgcggcgacggtc
gaacaggcgctcgaccgcatcgccgcccggctggaggagcatgtggacatcgccgccctg
ctggccgcggcgcgatga

DBGET integrated database retrieval system