KEGG   Azospirillum brasilense Sp245: AZOBR_160005Help
Entry
AZOBR_160005      CDS       T02152                                 

Definition
(GenBank) conserved hypothetical protein; putative DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AZOBR_160005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:abs01002]
    AZOBR_160005
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     AZOBR_160005
Peptidases [BR:abs01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   AZOBR_160005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: CCC98845
UniProt: G8AEM2
Position
complement(2405637..2406350)
Genome map
AA seq 237 aa AA seqDB search
MTENAPSFGLLLFPNVTQLDLTGPYEVLARVPGAQVHLLWKTLDPVRSDTGLTILPTSTL
AEAPPLDLLLVPGGGGINALLADEEVLAFLAERASGTRYLSGICTGSLVLGAAGLLEGKR
AGTHWASRGFLSAFGATPVAERVVVDGTLFTGGGVTAGIDVALRIVGELFGEQTAKLIQL
SIEYDPKPPFDSGSPDGAGAQVTDQLLARMRPMLDARAAAVAAGAEALRRRRSARAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaacgcgccaagcttcggcctgctgctgtttcccaacgtcacgcaactcgac
ctcaccggcccctatgaggtgctggctcgtgtgcccggcgcccaggtgcatctgctgtgg
aagacgctcgatccggtgcgctcggacaccggcctgaccattcttcccacctccaccctc
gccgaagcgccgccgctcgaccttcttctggtgccgggcggtggcgggatcaacgcgctg
ctcgccgacgaggaggtcctcgccttcctggcggaacgggcatccggcacccggtatctc
tccgggatctgcaccggttccctggtgctcggcgccgccgggttgctggaggggaagcgg
gccggcacgcattgggcgtcccgcggcttcctctccgcctttggcgccacgccggtcgcc
gagcgcgtggtggtggacggcacgctgttcaccggcggcggcgtgacggccggaatcgat
gtggcgctgcggatcgtcggcgaactgttcggcgagcagaccgcgaagctcatccagctt
tccatagaatacgacccgaagccccccttcgactccggttcgccggacggggcgggcgcc
caggtgacggaccagcttctcgcgcggatgcgcccgatgctggacgcgcgggcggcggcg
gtggcggcgggcgcggaggcgttgcgccgccgccggtccgctcgcgccagctga

DBGET integrated database retrieval system