KEGG   Azospirillum brasilense Sp245: AZOBR_200164Help
Entry
AZOBR_200164      CDS       T02152                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase, alpha subunit,NAD(P)-binding
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00020  Citrate cycle (TCA cycle)
abs00640  Propanoate metabolism
abs00660  C5-Branched dibasic acid metabolism
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01130  Biosynthesis of antibiotics
abs01200  Carbon metabolism
Module
abs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZOBR_200164 (sucD)
   00640 Propanoate metabolism
    AZOBR_200164 (sucD)
   00660 C5-Branched dibasic acid metabolism
    AZOBR_200164 (sucD)
Enzymes [BR:abs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AZOBR_200164 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Phage_GPO
Motif
Other DBs
NCBI-ProteinID: CCC99459
UniProt: G8AHT4
Position
2956742..2957617
Genome map
AA seq 291 aa AA seqDB search
MAVLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADA
VEKTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRALGNSKTRLI
GPNCPGIITPDECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGG
DPVNGTNFVDSLELFLKDPETEGIIMIGEIGGDAEVKGAEFIRDSGTKKPVVGFIAGRTA
PPGRRMGHAGAVISGGNDTADFKIEFMKSVGIAVADSPASLGSTMLKVFKG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctgttctcgtcgataagaacacgaaggtgatctgccagggcttcaccggagcccag
ggcaccttccattccgagcaggcgatcgcctacggcaccaagatggtcggcggcgtcacc
ccgggcaagggcggcaccaagcacctcgacctgccggtcttcgacacggtggccgacgcg
gtcgagaagaccggcgccaacgccagcgtcatctacgtgccgccgcccttcgccgccgac
gccatcctggaggcgatcgacgccgagatcccgctggtggtgtgcatcaccgagggcatc
ccggtgctcgacatggtgcgcgtcaagcgggcgctgggcaactccaagacccgcctgatc
gggccgaactgcccgggcatcatcacgcccgacgagtgcaagatcggcatcatgcccggc
cacatccacaagcgcggcaagatcggcatcgtctcgcgctcgggcacgctgacctacgag
gcggtggcgcagaccaccgcggcgggtctgggccagacgacctgcatcggcatcggcggc
gacccggtgaacgggacgaacttcgtggacagcctggagctgttcctgaaggacccggag
accgagggcatcatcatgatcggcgagatcggcggcgacgccgaggtcaagggcgcggag
ttcatccgcgactccgggaccaagaagccggtcgtcggcttcatcgccgggcgcaccgcg
cctccgggccgccgcatgggccacgccggcgcggtgatctccggcggcaacgacaccgcc
gacttcaagatcgagttcatgaagtccgtcggcatcgccgtcgccgacagccccgcgagc
ctgggttccaccatgctcaaggtcttcaagggctga

DBGET integrated database retrieval system