KEGG   Azospirillum brasilense Sp245: AZOBR_40127Help
Entry
AZOBR_40127       CDS       T02152                                 

Gene name
mls
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00620  Pyruvate metabolism
abs00630  Glyoxylate and dicarboxylate metabolism
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01200  Carbon metabolism
Module
abs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOBR_40127 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_40127 (mls)
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZOBR_40127 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCC96958
UniProt: G8AI55
Position
688825..690429
Genome map
AA seq 534 aa AA seqDB search
MATTISGLEILGPITPGVETILTPEALAFLAELEGRFGSERLRLLDVRTKRRALIDQGHR
PDFLPETRAIREADWTIAPLPHDLLDRRVEITGPVDRKMVINALNSGAKVFMADFEDSSC
PSWANLIEGQANLRDAVRRTIAFDDPVSGKKYRLNDKTAVLKVRPRGWHLAEKHVRFDGE
PVSGALFDFALYAFHNAQELLARGSGPYFYLPKLESHFEARLWNEVFSVAEDYLKIPHGS
IKATVLVETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKTFRNDPAAVLPDRAEVT
MATPFLQSYSLLAVKTCHRRGAPAIGGMAAYIPVKDDPAANETAFSKVRADKEREVSNGH
DGTWVAHPGLVPVAREVFDAYMRKPNQIDRKRADVSVTAADLLAVPEGPKTERGLRNNVA
VAIGYLEAWLRGIGCVPLFNLMEDAATAEISRTQLWQWVHHRATLDDGRPVTMELVDETI
AEELAAWKARVGDRAFDHGLYEEAAVMLRDLVERDDFVDFLTLPAYDRIVAQGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaccatctccgggcttgagatcctgggtccgatcacgccgggcgtcgagacg
atcctgacgccggaggcgctggccttcctggcggagctggaggggcggttcgggtcggag
cggttgcgcctgctcgacgtgcggaccaagcggcgggcgctgatcgaccagggccacagg
ccggacttcctgccggaaacccgcgccatccgtgaggctgactggaccatcgcgccgctg
ccgcacgacctgctcgatcgccgggtggagatcaccgggccggtggaccgcaagatggtc
atcaacgcgctgaattccggcgcgaaggtcttcatggcggatttcgaggattcgagctgc
ccgtcctgggccaacctgatcgaggggcaggccaacctgcgcgacgccgtgcgccggacc
atcgccttcgacgatcccgtgtcgggcaagaagtaccgtctgaacgacaagaccgccgtc
ctcaaggtccgcccgcgcggctggcatctggcggagaagcacgtccggttcgacggcgaa
ccggtgtccggcgcgctgttcgacttcgccctctacgccttccacaacgcgcaggagctt
ctggcccgcggctccggcccctacttctacctgccgaagctggaaagccatttcgaggcg
cggctgtggaacgaggtgttctcggtcgccgaggattatctcaagatcccgcacggctcg
atcaaggccacggtgctggtggaaaccatcctggccgccttcgagatggacgagatcctc
tacgagctgcgcgaccattccgccgggctgaactgcgggcgctgggactacatcttcagc
ttcatcaagaccttccgcaacgaccccgccgctgtcctgcccgaccgggcggaggtgacg
atggcgacgcccttcctgcagtcctacagcctgctggcggtcaagacctgccaccgccgt
ggcgccccggccatcggcggcatggccgcctacatcccggtgaaggacgatcccgcggcc
aacgagaccgccttctccaaggtccgcgccgacaaggagcgggaggtgtccaacggccat
gacggcacctgggtggcccaccccggcctcgtccccgtcgcgcgggaggtcttcgacgcc
tacatgcgcaaacccaaccagatcgaccgcaagcgcgccgacgtcagcgtgaccgccgcc
gacctgctggccgtcccggaggggccgaagacggagcgcggcctgcgcaacaacgtggcc
gtcgccatcggctatctggaggcgtggctgcgcggcatcggctgtgtgccgctgttcaac
ctgatggaggacgccgccaccgcggagatcagccgcacccagctctggcagtgggtccac
catcgcgccacgctggacgacgggcgcccggtgaccatggagctggtggacgagaccatc
gccgaggagctggccgcctggaaggcccgcgtcggcgaccgcgccttcgaccatggtctg
tacgaggaggccgcggtgatgctgcgcgacctcgtggagcgggacgacttcgtggatttc
ctgaccctgccggcctacgaccgcatcgtcgcgcagggggcgtga

DBGET integrated database retrieval system