KEGG   Azospirillum brasilense Sp245: AZOBR_40173Help
Entry
AZOBR_40173       CDS       T02152                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00860  Porphyrin and chlorophyll metabolism
abs01100  Metabolic pathways
Module
abs_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZOBR_40173
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AZOBR_40173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCC97004
UniProt: G8AIA1
Position
complement(730442..731068)
Genome map
AA seq 208 aa AA seqDB search
MKNTRWWLIRHAPVPNPGNAIYGRSDPAADTGDSDALAALAARLPAQAVWVTSHLRRTRQ
TAAALRLPGSDMALVERALAEQDFGRWEGLSHDAVAELHPEEARRFWSDPAAKAPPDGES
FKAVMERVAGAVARLTDLYAGRDIVAVIHGGSIRAALALALDLTPQAALRLAVAPLSLSR
IDHYGSDEGGSWSVAALNALGTFPGSGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacactcgctggtggctcatccgccacgctcccgtcccgaatccgggaaacgcg
atctacggacggagcgatcccgccgccgacaccggcgattccgacgcgctggcggcgctg
gcggcgcggctgcccgcgcaggcggtctgggtgacctcgcatctgcgccgcacccggcag
acggcggcggcgctgcggctgcccggcagcgacatggcgctggtcgagcgggcgctggcc
gaacaggatttcggccgctgggaagggctgtcccacgacgccgtggcggagctgcatccc
gaggaggcccgccgcttctggagcgacccggcggcgaaggccccgccggacggcgagagc
tttaaggcggtgatggagcgggtggccggcgccgtcgcccggctgaccgacctctacgcc
gggcgcgacatcgtggcggtgatccatggtgggtcgatccgcgcggcgctggcgctcgcc
ctggacctgacgccgcaggcggcgctgcggctggcggtggcgccgctctcgctgtcgcgg
atcgaccattacggcagcgacgaaggcggttcgtggtcggtcgcggccctgaacgcgctc
ggaacctttccaggcagcgggcgttga

DBGET integrated database retrieval system