KEGG   Azospirillum brasilense Sp245: AZOBR_70023Help
Entry
AZOBR_70023       CDS       T02152                                 

Definition
(GenBank) putative lysophospholipase L2, (Lecithinase B)
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZOBR_70023
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZOBR_70023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_4 Esterase Peptidase_S9 LCAT Ser_hydrolase PGAP1 DUF900 Thioesterase
Motif
Other DBs
NCBI-ProteinID: CCC97387
UniProt: G8AJH5
Position
1083360..1084301
Genome map
AA seq 313 aa AA seqDB search
MAVSVADLGVGPRFGWVTMGDGTRLRTAHWTATKAPPRGTALLLTGRAEFIEKYTETAGA
MLARGFEVFTFDWRNQGLSDRPLPNPQIHHLDSFDTLAGDLDEVVERLVRPRQHGPLLLL
AHSMGGLVALMALLRNPALCDAAVLTAPMFDIFTGPVPRRMAVWLAERLCARGRAAEYAF
GQHDYDPVEGLFTPVNPITSDPRRYATYHDAFRDRPELRVGGVSFGWVRAALRASDHIRF
TAPLERVTTPILLLSAPADAVVRAESHRLAAARLGNAVLKEHSDAKHELLMERDDIRDRV
WADVDAFLAALHM
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgagcgtggcggatctgggtgtggggccacggttcggctgggtgacgatgggg
gatgggacccggctgcgcaccgcccattggacggccaccaaagccccgccgcgcggcacc
gcgctgctgctgaccggtcgggcggagttcatcgagaagtacaccgagacggcgggtgcg
atgctcgcccgcggcttcgaggtcttcaccttcgactggcgcaaccaggggctgtccgac
cgccccctgcccaacccccagattcatcacctggacagcttcgacacgctggccggcgat
ctcgacgaggtggtggagcggctggtgaggccgcggcagcacgggccgctgctgctgctt
gcccacagcatgggcgggctggtcgccctgatggccctgctgcgaaacccggccctgtgc
gacgccgcggtgctgacggcgccgatgttcgacatcttcaccggcccggtgccgcgccgc
atggcggtctggctggccgaacgcctgtgcgcccgcgggcgggccgccgaatacgccttc
ggccagcacgattacgacccggtggaggggctgttcaccccggtcaacccgatcacctcc
gacccccgccgctacgccacttaccacgacgccttccgcgaccggcccgagttgcgggtg
ggcggggtcagcttcggctgggtgcgggcggccctgcgcgcctccgaccacatccgcttc
accgccccgctggagcgggtgacgacccccatcctgctgctgagcgccccggccgacgcc
gtcgtccgcgcggagtcgcaccggctggccgccgcccggctgggcaacgccgtgctgaag
gagcattccgacgccaagcacgagctgctgatggagcgcgacgacatccgcgaccgggtg
tgggcggacgtcgacgccttcctggccgccctacatatgtaa

DBGET integrated database retrieval system