KEGG   Azospirillum brasilense Sp245: AZOBR_p1140130
Entry
AZOBR_p1140130    CDS       T02152                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K11897  type VI secretion system protein ImpF
Organism
abs  Azospirillum brasilense Sp245
Brite
KEGG Orthology (KO) [BR:abs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abs02044]
    AZOBR_p1140130
Secretion system [BR:abs02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZOBR_p1140130
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CCD01115
UniProt: G8APE2
Position
AZOBR_p1:complement(1549514..1549987)
AA seq 157 aa
MTQPKTMTGGRSLLFERLIDFEPDHPTGDEPSATVLSMPDLKASIQREVARILDSRSTGT
RRPDLGGTALDYGISDITHLDAASDADRRQVERMVRQAIIDFEPRLKRPRVTVSAGTGRG
TMVTSISGEVVAGTVTERLEFDVGLRGPAATEPSQSG
NT seq 474 nt   +upstreamnt  +downstreamnt
atgacccagcccaagacgatgaccggcggacggtcgctgctgttcgaacggctgatcgac
ttcgaaccggaccacccgacgggcgacgagccgtccgccacggtgctgtccatgcccgac
ctcaaggcgtcgattcagcgcgaggtggcgcgcatcctcgacagccgcagcaccggcacg
cgccgccccgacctcggcggaacggcgctggactatgggatttccgacatcacgcatctg
gacgccgcttccgacgccgaccgccgtcaggtggagcggatggtgcggcaggccatcatc
gatttcgagccgcggctgaagcgcccgcgggtgaccgtcagcgccggaaccgggcgcggc
accatggtcaccagcatctccggcgaggtcgtggcgggcaccgtcaccgaacggctggag
ttcgacgtgggcctgcgcggcccggccgccaccgagccaagccagtccggctga

DBGET integrated database retrieval system