KEGG   Azospirillum brasilense Sp245: AZOBR_p1140131Help
Entry
AZOBR_p1140131    CDS       T02152                                 

Definition
(GenBank) conserved protein of unknown function
Organism
abs  Azospirillum brasilense Sp245
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CCD01116
UniProt: G8APE3
Position
AZOBR_p1:complement(1550152..1550619)
Genome map
AA seq 155 aa AA seqDB search
MEIAGGVVFKDMILCESLSQDMTVEMEVSTNARRTVHTPKVENITLERKWDRASPKLISL
LLRSANSDTAKKQWTIHCLKPIGDSHQWGEFLTIELTNPLIAKHSLSVNEGDTTETIEIN
ATEIYWTYKRYTEEQKHEGGGGVKFNLLKGTVSDS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcgccgggggcgtggtgttcaaggacatgatcctgtgcgaatccctgtcgcag
gacatgaccgtcgaaatggaagtgtcgaccaacgcccgccgcacggtccacaccccgaag
gtcgagaacatcacccttgagcgcaagtgggaccgggcctcgcccaagctgatctcgctg
ctgctgcgctcggccaactccgacacggcgaagaagcagtggaccatccattgcctgaag
ccgatcggcgacagccaccagtggggcgagttcctgacgatcgagctgaccaacccgctg
atcgccaagcacagcctgagcgtcaacgagggcgacacgaccgagaccatcgagatcaac
gccaccgagatctactggacctacaagcgctacaccgaggagcagaagcacgaaggcggt
ggcggcgtgaagttcaacctgctgaagggcaccgtctccgacagctga

DBGET integrated database retrieval system