KEGG   Azospirillum brasilense Sp245: AZOBR_p1150009
Entry
AZOBR_p1150009    CDS       T02152                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K11892  type VI secretion system protein ImpK
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZOBR_p1150009
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abs02044]
    AZOBR_p1150009
Secretion system [BR:abs02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZOBR_p1150009
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CCD01131
UniProt: G8APF8
Position
AZOBR_p1:1563329..1564213
AA seq 294 aa
MTAMLHRRDLVDHFLAFARELQKHRAAVGAGRPAAAAAKPEGAAGETADSLPAFLTEDAL
AIPAPRGGIAAVPALALEPDAEIIIRRLQDFLEAQAVQVGRTGTDLMISQHREAQYAMAA
LADDLFIHDVEWNGRELWRSVLLEQAVFRTRLAGERVFDRMEALLASNDRRLVQLAAVYL
FVLGMGFKGRCRVPGGESTLRDYSARLFEFIAGRESELGAGVLPGGRTLIPAAYAYTLTD
GKARTLARGPRWPLVLGAIAGLWLVLGQALWWMSTAQLSNAADAVLQASVRVTR
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaccgccatgctgcaccgccgggatctggtcgatcacttcctcgccttcgcgcgggaa
ctccagaagcaccgcgccgcggtcggggcgggccgtcccgccgccgctgcggcgaagcca
gagggcgccgcgggggagacggcggacagcctgccggcctttctgaccgaggacgccctg
gcgatcccggcgccccgcggtggcatcgcggcggtgccggccctggcgctggagcccgac
gccgagatcatcatccgccgccttcaggacttcctggaggcgcaggcggtccaagtcggg
cgcaccggcaccgacctgatgatcagccagcaccgcgaggcccaatacgccatggcggcg
ctggccgacgacctgttcatccacgacgtggagtggaacgggcgggagctgtggcgcagc
gttctgctggagcaggcggtgttccgcacccggctggccggcgagcgggtgttcgaccgc
atggaggcgctgctcgccagcaacgaccgtcggctggtccagctggcggcggtgtatctc
ttcgtgctcggcatgggcttcaaggggcgctgccgggtgccgggcggcgaatccaccctg
cgcgactacagcgcccgcctgttcgagttcatcgccggccgcgagtccgagctgggcgcc
ggtgtgctgcccggcgggcgcacgctgatccccgctgcctacgcctacacgctgaccgac
ggcaaggcgcgcacgctggcgcgcgggccgcgctggccgctggtgctgggggccatagcc
gggctgtggctggtgctgggtcaggcgctctggtggatgtccacggcgcagctttccaac
gcggcggacgcggtgcttcaggcatcggtccgcgtgacccgctga

DBGET integrated database retrieval system